Anti-GJA3 Antibody | Boster Immunoleader PB9596 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-GJA3 Antibody

catalog :

PB9596

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-GJA3 Antibody

Catalog Number :

PB9596

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).

Reference :

1. Burdon, K. P., Wirth, M. G., Mackey, D. A., Russell-Eggitt, I. M., Craig, J. E., Elder, J. E., Dickinson, J. L., Sale, M. M. A novel mutation in the connexin 46 gene causes autosomal dominant congenital cataract with incomplete penetrance. J. Med. Genet. 41: e106, 2004. Note: Electronic Article. Errata: J. Med. Genet. 42: 288 only, 2004; J. Med. Genet. 45: 256 only, 2008. 2. Chang, B., Wang, X., Hawes, N. L., Ojakian, R., Davisson, M. T., Lo, W.-K., Gong, X. A Gja8 (Cx50) point mutation causes an alteration of alpha-3 connexin (Cx46) in semi-dominant cataracts of Lop10 mice. Hum. Molec. Genet. 11: 507-513, 2002. 3. White, T. W. Unique and redundant connexin contributions to lens development.Science 295: 319-320, 2002.

Gene Name :

GJA3

Protein Name :

Gap junction alpha-3 protein

Gene Full Name :

gap junction protein, alpha 3, 46kDa

Synonyms :

CAE3 antibody Connexin 46 antibody Connexin-46 antibody Connexin46 antibody Cx46 antibody CXA3_HUMAN antibody CZP3 antibody Gap junction alpha 3 protein antibody Gap junction alpha-3 protein antibody Gap junction protein, alpha 3, 46kD (connexin 46) antibody Gap junction protein, alpha 3, 46kDa (connexin 46) antibody Gap junction protein, alpha 3, 46kDa antibody Gja3 antibody

Uniprot ID :

Q9Y6H8

more info or order :

Boster Immunoleader product webpage