Boster Immunoleader

antibody

Anti-Fascin Antibody

PB9592

100 ug/vial

240 USD

polyclonal

rabbit

human, rat

Anti-Fascin Antibody

PB9592

Polyclonal

Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, rat

WB

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.

1. Saishin, Y., Shimada, S., Morimura, H., Sato, K., Ishimoto, I., Tano, Y., Tohyama, M.Isolation of a cDNA encoding a photoreceptor cell-specific actin-bundling protein: retinal fascin.FEBS Lett. 414: 381-386, 1997. 2. Wada, Y., Abe, T., Takeshita, T., Sato, H., Yanashima, K., Tamai, M.Mutation of human retinal fascin gene (FSCN2) causes autosomal dominant retinitis pigmentosa.Invest. Ophthal. Vis. Sci. 42: 2395-2400, 2001.

FSCN1

Fascin

fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)

55 kDa actin bundling protein antibody 55 kDa actin-bundling protein antibody Actin bundling protein antibody actin bundling protein, 55-KD antibody FAN 1 antibody FAN1 antibody Fascin 1 antibody Fascin antibody Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody Fascin homolog 1 antibody Fascin, sea urchin, homolog of, 1 antibody Fascin1 antibody FLJ38511 antibody FSCN 1 antibody FSCN1 antibody FSCN1_HUMAN antibody HSN antibody p55 antibody Singed (Drosophila) like (sea urchin fascin homolog like) antibody Singed drosophila homolog like antibody Singed like (fascin homolog sea urchin) (Drosophila) antibody Singed like (fascin homolog sea urchin) antibody Singed like protein antibody Singed, drosophila, homolog of antibody Singed-like protein antibody SNL antibody Strongylocentrotus purpuratus antibody

Q16658