product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-FMO3 Antibody
catalog :
PB9590
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-FMO3 Antibody
Catalog Number :
PB9590
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3(FMO3) detection. Tested with WB in Human;Mouse; Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.
Reference :
1. Akerman, B. R., Chow, L., Forrest, S., Youil, R., Cashman, J., Treacy, E. P. Mutations in the flavin-containing monoxygenase (sic) form 3 (FMO3) gene cause trimethylaminuria, fish odour syndrome. (Abstract) Am. J. Hum. Genet. 61 (suppl.): A53 only, 1997.
2. Cashman, J. R., Zhang, J. Interindividual differences of human flavin-containing monooxygenase 3: genetic polymorphisms and functional variation. Drug Metab. Dispos. 30: 1043-1052, 2002.
3. Dolphin, C. T., Janmohamed, A., Smith, R. L., Shephard, E. A., Phillips, I. R. Missense mutation in flavin-containing mono-oxygenase 3 gene, FMO3, underlies fish-odour syndrome. Nature Genet. 17: 491-494, 1997.
Gene Name :
FMO3
Protein Name :
Dimethylaniline monooxygenase [N-oxide-forming] 3
Gene Full Name :
flavin containing monooxygenase 3
Synonyms :
Dimethylaniline monooxygenase [N oxide forming] 3 antibody Dimethylaniline monooxygenase [N-oxide-forming] 3 antibody Dimethylaniline monooxygenase 3 antibody Dimethylaniline oxidase 3 antibody dJ127D3.1 antibody Flavin containing monooxygenase 3 antibody FMO 3 antibody FMO form 2 antibody FMO II antibody FMO3 antibody FMO3_HUMAN antibody FMOII antibody Hepatic flavin containing monooxygenase 3 antibody Hepatic flavin-containing monooxygenase 3 antibody MGC34400 antibody TMAU antibody Trimethylamine monooxygenase antibody
Uniprot ID :
P31513
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
