product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-FMO1 Antibody
catalog :
PB9589
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-FMO1 Antibody
Catalog Number :
PB9589
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human;Mouse; Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.
Reference :
1. "Entrez Gene: FMO1 flavin containing monooxygenase 1".
2. Cashman JR (2004). "The implications of polymorphisms in mammalian flavin-containing monooxygenases in drug discovery and development".Drug Discov. Today 9 (13): 574–581.
3. Dolphin C, Shephard EA, Povey S et al. (1991). "Cloning, primary sequence, and chromosomal mapping of a human flavin-containing monooxygenase (FMO1)".J. Biol. Chem. 266 (19): 12379–85.
Gene Name :
FMO1
Protein Name :
Dimethylaniline monooxygenase [N-oxide-forming] 1
Gene Full Name :
flavin containing monooxygenase 1
Synonyms :
Dimethylaniline monooxygenase [N oxide forming] 1 antibody Dimethylaniline monooxygenase [N-oxide-forming] 1 antibody Dimethylaniline oxidase 1 antibody Fetal hepatic flavin containing monooxygenase 1 antibody Fetal hepatic flavin-containing monooxygenase 1 antibody Flavin containing monooxygenase 1 (fetal liver) antibody Flavin Containing Monooxygenase 1 antibody FMO 1 antibody FMO1 antibody FMO1_HUMAN antibody OTTHUMP00000033536 antibody OTTHUMP00000033537 antibody
Uniprot ID :
Q01740
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
