Anti-EWSR1 Antibody | Boster Immunoleader PB9585 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-EWSR1 Antibody

catalog :

PB9585

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-EWSR1 Antibody

Catalog Number :

PB9585

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Reference :

1. "Entrez Gene: EWSR1 Ewing sarcoma breakpoint region 1". 2. Delattre O, Zucman J, Plougastel B, Desmaze C, Melot T, Peter M, Kovar H, Joubert I, de Jong P, Rouleau G (October 1992). "Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours". Nature 359 (6391): 162–5.

Gene Name :

EWSR1

Protein Name :

RNA-binding protein EWS

Gene Full Name :

EWS RNA-binding protein 1

Synonyms :

bK984G1.4 antibody bK984G1.4 Ewing sarcoma breakpoint region 1 protein antibody Ewing sarcoma breakpoint region 1 antibody Ewing sarcoma breakpoint region 1 protein antibody Ewings sarcoma EWS Fli1 type 1 oncogene antibody EWS antibody EWS oncogene antibody EWS RNA binding protein 1 antibody EWS_HUMAN antibody EWSR 1 antibody Ewsr1 antibody EWSR1 protein antibody RNA binding protein EWS antibody RNA-binding protein EWS antibody

Uniprot ID :

Q01844

more info or order :

Boster Immunoleader product webpage