Boster Immunoleader

antibody

Anti-CD26 Antibody

PB9580

100 ug/vial

240 USD

polyclonal

rabbit

human, rat

Anti-CD26 Antibody

PB9580

Polyclonal

Rabbit IgG polyclonal antibody for Dipeptidyl peptidase 4(DPP4) detection. Tested with WB in Human;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, rat

WB

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ), different from the related mouse and rat sequences by three amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Dipeptidyl peptidase-4 (DPP4), also known as CD26 (cluster of differentiation 26) is a protein that, in humans, is encoded by the DPP4 gene. The protein encoded by the DPP4 gene is an antigenic enzyme expressed on the surface of most cell types and is associated with immune regulation, signal transduction and apoptosis. Also, it is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. DPP4 plays a major role in glucose metabolism. It is responsible for the degradation ofincretins such as GLP-1. Furthermore, it appears to work as a suppressor in the development of cancer andtumours.

1. Barnett A (Nov 2006). "DPP-4 inhibitors and their potential role in the management of type 2 diabetes".International Journal of Clinical Practice60 (11): 1454–70. 2. Kameoka J, Tanaka T, Nojima Y, Schlossman SF, Morimoto C (Jul 1993). "Direct association of adenosine deaminase with a T cell activation antigen, CD26".Science 261 (5120): 466–9. 3. Pro B, Dang NH (Oct 2004). "CD26/dipeptidyl peptidase IV and its role in cancer". Histology and Histopathology 19 (4): 1345–51.

DPP4

Dipeptidyl peptidase 4

dipeptidyl-peptidase 4

CD26 antigen antibody ADA-binding protein antibody ADABP antibody ADCP 2 antibody ADCP-2 antibody ADCP2 antibody Adenosine deaminase complexing protein 2 antibody CD 26 antibody CD26 antibody CD26 antigen 3 antibody Dipeptidyl peptidase 4 antibody Dipeptidyl peptidase 4 soluble form antibody Dipeptidyl peptidase IV antibody Dipeptidyl peptidase IV membrane form antibody Dipeptidyl peptidase IV soluble form antibody Dipeptidyl peptidase, intestinal antibody Dipeptidylpeptidase 4 antibody Dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2) antibody Dipeptidylpeptidase IV antibody DPP 4 antibody DPP IV antibody DPP IV estoenzyme antibody DPP4 antibody DPP4_HUMAN antibody DPPIV antibody Intestinal dipeptidyl peptidase antibody T cell activation antigen CD26 antibody T-cell activation antigen CD26 antibody TP 103 antibody TP103 antibody

P27487