Anti-AHSG Antibody | Boster Immunoleader PB9568 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-AHSG Antibody

catalog :

PB9568

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, rat

application :

western blot, ELISA, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-AHSG Antibody

Catalog Number :

PB9568

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein(AHSG) detection. Tested with WB, IHC-P, ELISA in Human;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, rat

Applications :

WB,IHC-P,ELISA

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human

ELISA :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.

Reference :

1. "Entrez Gene: AHSG alpha-2-HS-glycoprotein". 2. Osawa M, Umetsu K, Sato M, Ohki T, Yukawa N, Suzuki T, Takeichi S (September 1997). "Structure of the gene encoding human alpha 2-HS glycoprotein (AHSG)". Gene 196 (1-2): 121–5. 3. Rizzu P, Baldini A (1995). "Three members of the human cystatin gene superfamily, AHSG, HRG, and KNG, map within one megabase of genomic DNA at 3q27". Cytogenet. Cell Genet. 70 (1-2): 26–8.

Gene Name :

AHSG

Protein Name :

Alpha-2-HS-glycoprotein

Gene Full Name :

alpha-2-HS-glycoprotein

Synonyms :

59 kDa bone sialic acid-containing protein antibody A2HS antibody Aa2-066 antibody AHS antibody Ahsg alpha-2-HS-glycoprotein antibody Ahsg antibody Alpha 2 HS Glycoprotein antibody Alpha 2 Z globulin antibody Alpha-2-HS-glycoprotein antibody Alpha-2-HS-glycoprotein chain B antibody Alpha-2-Z-globulin antibody Asialofetuin antibody Ba alpha 2 glycoprotein antibody Ba-alpha-2-glycoprotein antibody BSP antibody Countertrypin antibody Fetua antibody FETUA_HUMAN antibody Fetuin, mouse, homolog of antibody Fetuin A antibody Fetuin-A antibody Glycoprotein PP63 antibody HSGA antibody pp63 antibody

Uniprot ID :

P02765

more info or order :

Boster Immunoleader product webpage