product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-AHSG Antibody
catalog :
PB9568
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
Product Name :
Anti-AHSG Antibody
Catalog Number :
PB9568
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein(AHSG) detection. Tested with WB, IHC-P, ELISA in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB,IHC-P,ELISA
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human
ELISA :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
Reference :
1. "Entrez Gene: AHSG alpha-2-HS-glycoprotein". 2. Osawa M, Umetsu K, Sato M, Ohki T, Yukawa N, Suzuki T, Takeichi S (September 1997). "Structure of the gene encoding human alpha 2-HS glycoprotein (AHSG)". Gene 196 (1-2): 121–5. 3. Rizzu P, Baldini A (1995). "Three members of the human cystatin gene superfamily, AHSG, HRG, and KNG, map within one megabase of genomic DNA at 3q27". Cytogenet. Cell Genet. 70 (1-2): 26–8.
Gene Name :
AHSG
Protein Name :
Alpha-2-HS-glycoprotein
Gene Full Name :
alpha-2-HS-glycoprotein
Synonyms :
59 kDa bone sialic acid-containing protein antibody A2HS antibody Aa2-066 antibody AHS antibody Ahsg alpha-2-HS-glycoprotein antibody Ahsg antibody Alpha 2 HS Glycoprotein antibody Alpha 2 Z globulin antibody Alpha-2-HS-glycoprotein antibody Alpha-2-HS-glycoprotein chain B antibody Alpha-2-Z-globulin antibody Asialofetuin antibody Ba alpha 2 glycoprotein antibody Ba-alpha-2-glycoprotein antibody BSP antibody Countertrypin antibody Fetua antibody FETUA_HUMAN antibody Fetuin, mouse, homolog of antibody Fetuin A antibody Fetuin-A antibody Glycoprotein PP63 antibody HSGA antibody pp63 antibody
Uniprot ID :
P02765
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits