product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SPARC Antibody
catalog :
PB9559
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
more info or order :
product information
Product Name :
Anti-SPARC Antibody
Catalog Number :
PB9559
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for SPARC(SPARC) detection. Tested with WB in Human.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human SPARC (268-303aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
SPARC, secreted protein acidic and rich in cysteine , also known as Osteonectin is a protein that in humans is encoded by the SPARC gene. The human SPARC gene is 26.5 kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33. SPARC is a glycoprotein of 40 kD. SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine- rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV). Osteonectin is a glycoprotein in the bone that binds sodium. It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation. Osteonectin also shows affinity for collagen in addition to bone mineral calcium. A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found.
Reference :
1. Gilmour, D. T., Lyon, G. J., Carlton, M. B. L., Sanes, J. R., Cunningham, J. M., Anderson, J. R., Hogan, B. L. M., Evans, M. J., Colledge, W. H.Mice deficient for the secreted glycoprotein SPARC/osteonectin/BM40 develop normally but show severe age-onset cataract formation and disruption of the lens.EMBO J. 17: 1860-1870, 1998.
2. Goldblum, S. E., Ding, X., Funk, S. E., Sage, E. H.SPARC (secreted protein acidic and rich in cysteine) regulates endothelial cell shape and barrier function.Proc. Nat. Acad. Sci. 91: 3448-3452, 1994.
3. Minn, A. J., Gupta, G. P., Siegel, P. M., Bos, P. D., Shu, W., Giri, D. D., Viale, A., Olshen, A. B., Gerald, W. L., Massague, J.Genes that mediate breast cancer metastasis to lung.Nature 436: 518-524, 2005.
Gene Name :
SPARC
Protein Name :
SPARC
Gene Full Name :
secreted protein, acidic, cysteine-rich (osteonectin)
Synonyms :
AA517111 antibody Basement membrane protein 40 antibody Basement-membrane protein 40 antibody BM 40 antibody BM-40 antibody BM40 antibody Cysteine rich protein antibody hm:zeh0062 antibody MGC128090 antibody ON antibody Osteonectin antibody Secreted acidic cystein rich glycoprotein antibody Secreted protein acidic and rich in cysteine antibody Secreted protein acidic cysteine rich (osteonectin) antibody Secreted protein acidic cysteine rich antibody SPARC antibody SPRC antibody SPRC_HUMAN antibody
Uniprot ID :
P09486
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
