Anti-SP2 Antibody | Boster Immunoleader PB9557 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-SP2 Antibody

catalog :

PB9557

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, rat

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-SP2 Antibody

Catalog Number :

PB9557

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Transcription factor Sp2(SP2) detection. Tested with WB in Human;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, rat

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human SP2 (312-343aa QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ), identical to the related mouse sequence.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.

Reference :

1. Kingsley C, Winoto A (Oct 1992). "Cloning of GT box-binding proteins: a novel Sp1 multigene family regulating T-cell receptor gene expression". Mol Cell Biol 12 (10): 4251–61. 2. Rotheneder H, Geymayer S, Haidweger E (Nov 1999). "Transcription factors of the Sp1 family: interaction with E2F and regulation of the murine thymidine kinase promoter". J. Mol. Biol. 293 (5): 1005–15. 3. Scohy S, Van Vooren P, Szpirer C, Szpirer J (Oct 1998). "Assignment1 of Sp genes to rat chromosome bands 7q36 (Sp1), 10q31→q32.1 (Sp2), 3q24→q31 (Sp3) and 6q33 (Sp4) and of the SP2 gene to human chromosome bands 17q21.3→q22 by in situ hybridization". Cytogenet Cell Genet 81 (3–4): 273–4.

Gene Name :

SP2

Protein Name :

Transcription factor Sp2

Gene Full Name :

Sp2 transcription factor

Synonyms :

Kiaa0048 antibody OTTHUMP00000196580 antibody SP2 antibody SP2_HUMAN antibody SPECIFICITY PROTEIN 2 antibody Transcription factor Sp2 antibody

Uniprot ID :

Q02086

more info or order :

Boster Immunoleader product webpage