product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SP2 Antibody
catalog :
PB9557
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-SP2 Antibody
Catalog Number :
PB9557
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Transcription factor Sp2(SP2) detection. Tested with WB in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human SP2 (312-343aa QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ), identical to the related mouse sequence.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.
Reference :
1. Kingsley C, Winoto A (Oct 1992). "Cloning of GT box-binding proteins: a novel Sp1 multigene family regulating T-cell receptor gene expression". Mol Cell Biol 12 (10): 4251–61.
2. Rotheneder H, Geymayer S, Haidweger E (Nov 1999). "Transcription factors of the Sp1 family: interaction with E2F and regulation of the murine thymidine kinase promoter". J. Mol. Biol. 293 (5): 1005–15.
3. Scohy S, Van Vooren P, Szpirer C, Szpirer J (Oct 1998). "Assignment1 of Sp genes to rat chromosome bands 7q36 (Sp1), 10q31→q32.1 (Sp2), 3q24→q31 (Sp3) and 6q33 (Sp4) and of the SP2 gene to human chromosome bands 17q21.3→q22 by in situ hybridization". Cytogenet Cell Genet 81 (3–4): 273–4.
Gene Name :
SP2
Protein Name :
Transcription factor Sp2
Gene Full Name :
Sp2 transcription factor
Synonyms :
Kiaa0048 antibody OTTHUMP00000196580 antibody SP2 antibody SP2_HUMAN antibody SPECIFICITY PROTEIN 2 antibody Transcription factor Sp2 antibody
Uniprot ID :
Q02086
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments