Anti-Parvin alpha Antibody | Boster Immunoleader PB9555 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-Parvin alpha Antibody

catalog :

PB9555

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-Parvin alpha Antibody

Catalog Number :

PB9555

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Alpha-parvin(PARVA) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.

Reference :

1. "Entrez Gene: PARVA parvin, alpha". 2. Olski TM, Noegel AA, Korenbaum E (Feb 2001). "Parvin, a 42 kDa focal adhesion protein, related to the alpha-actinin superfamily". J Cell Sci 114 (Pt 3): 525–38. 3. Zhang Y, Chen K, Tu Y, Wu C (2004). "Distinct roles of two structurally closely related focal adhesion proteins, alpha-parvins and beta-parvins, in regulation of cell morphology and survival.". J. Biol. Chem. 279 (40): 41695–705.

Gene Name :

PARVA

Protein Name :

Alpha-parvin

Gene Full Name :

parvin, alpha

Synonyms :

Actopaxin antibody Alpha parvin antibody Alpha-parvin antibody Calponin like integrin linked kinase binding protein antibody Calponin-like integrin-linked kinase-binding protein antibody CH ILKBP antibody CH-ILKBP antibody FLJ10793 antibody FLJ12254 antibody Matrix remodelling associated 2 antibody Matrix remodelling associated protein 2 antibody Matrix-remodeling-associated protein 2 antibody MXRA 2 antibody MXRA2 antibody PARV A antibody PARVA antibody PARVA_HUMAN antibody

Uniprot ID :

Q9NVD7

more info or order :

Boster Immunoleader product webpage