product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-CYP27B1 Antibody
catalog :
PB9548
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-CYP27B1 Antibody
Catalog Number :
PB9548
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (CYP27B1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR), different from the related mouse and rat sequences by six amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.
Reference :
1. "Entrez Gene: cytochrome P450".
2. Monkawa T, Yoshida T, Wakino S, Shinki T, Anazawa H, Deluca HF et al. (Oct 1997). "Molecular cloning of cDNA and genomic DNA for human 25-hydroxyvitamin D3 1 alpha-hydroxylase". Biochemical and Biophysical Research Communications 239 (2): 527–33.
3. Takeyama K, Kitanaka S, Sato T, Kobori M, Yanagisawa J, Kato S (Sep 1997). "25-Hydroxyvitamin D3 1alpha-hydroxylase and vitamin D synthesis". Science (New York, N.Y.) 277 (5333): 1827–30.
Gene Name :
CYP27B1
Protein Name :
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
Gene Full Name :
cytochrome P450, family 27, subfamily B, polypeptide 1
Synonyms :
1alpha(OH)ase antibody 25-hydroxyvitamin D(3) 1-alpha-hydroxylase antibody 25-hydroxyvitamin D-1 alpha hydroxylase antibody 25-OHD-1 alpha-hydroxylase antibody Calcidiol 1-monooxygenase antibody CP27B_HUMAN antibody CP2B antibody CYP1 antibody CYP1ALPHA antibody CYP27B antibody Cyp27b1 antibody Cytochrome p450 27B1 antibody Cytochrome p450 27B13 antibody Cytochrome P450 family 27 subfamily B polypeptide 1 antibody Cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1 antibody Cytochrome P450 subfamily XXVIIB polypeptide 1 antibody Cytochrome P450C1 alpha antibody Cytochrome P450VD1-alpha antibody mitochondrial antibody P450C1 alpha antibody P450c1 antibody P450C1-alpha antibody P450VD1-alpha antibody PDDR antibody VD3 1A hydroxylase antibody VDD1 antibody VDDR antibody VDDR I antibody VDDRI antibody VDR antibody
Uniprot ID :
O15528
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
