Anti-Cryptochrome I Antibody | Boster Immunoleader PB9540 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-Cryptochrome I Antibody

catalog :

PB9540

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, rat

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-Cryptochrome I Antibody

Catalog Number :

PB9540

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, rat

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Reference :

1. Griffin EA, Staknis D, Weitz CJ (October 1999). "Light-independent role of CRY1 and CRY2 in the mammalian circadian clock". Science 286 (5440): 768–71. 2. Ukai-Tadenuma M, Yamada RG, Xu H, Ripperger JA, Liu AC, Ueda HR (Jan 2011). "Delay in feedback repression by cryptochrome 1 is required for circadian clock function". Cell 144 (2): 268–81.

Gene Name :

CRY1

Protein Name :

Cryptochrome-1

Gene Full Name :

cryptochrome circadian clock 1

Synonyms :

Cry1 antibody CRY1_HUMAN antibody Cryptochrome 1 (photolyase like) antibody Cryptochrome 1 antibody Cryptochrome-1 antibody PHLL1 antibody Photolyase 1 antibody Photolyase-like antibody

Uniprot ID :

Q16526

more info or order :

Boster Immunoleader product webpage