product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-APRIL Antibody
catalog :
PB9523
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot, ELISA
more info or order :
product information
Product Name :
Anti-APRIL Antibody
Catalog Number :
PB9523
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Tumor necrosis factor ligand superfamily member 13 (TNFSF13) detection. Tested with WB, ELISA in Human.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB,ELISA
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
ELISA :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
A proliferation-inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI. The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. And this protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
Reference :
1. "Entrez Gene: TNFSF13 tumor necrosis factor (ligand) superfamily, member 13".
2. Hahne M, Kataoka T, Schröter M, Hofmann K, Irmler M, Bodmer JL et al. (Sep 1998). "APRIL, a new ligand of the tumor necrosis factor family, stimulates tumor cell growth". The Journal of Experimental Medicine 188 (6): 1185–90.
Gene Name :
TNFSF13
Protein Name :
Tumor necrosis factor ligand superfamily member 13
Gene Full Name :
tumor necrosis factor (ligand) superfamily, member 13
Synonyms :
A proliferation inducing ligand antibody A proliferation-inducing ligand antibody APRIL antibody CD 256 antibody CD256 antibody CD256 antigen antibody Ligand antibody PRO715 antibody Proliferation inducing ligand APRIL antibody TALL 2 antibody TALL-2 antibody TALL2 antibody TNF and APOL related leukocyte expressed ligand 2 antibody TNF related death ligand 1 antibody TNF related death ligand antibody TNF- and APOL-related leukocyte expressed ligand 2 antibody TNF-related death ligand 1 antibody TNF13_HUMAN antibody TNFSF 13 antibody TNFSF13 antibody TNFSF13 protein antibody TRDL 1 antibody TRDL-1 antibody TRDL1 antibody Tumor necrosis factor (ligand) superfamily member 13 antibody Tumor necrosis factor (ligand) superfamily, member 13 antibody Tumor necrosis factor ligand superfamily member 13 antibody Tumor necrosis factor like protein ZTNF2 antibody Tumor necrosis factor related death ligand antibody Tumor necrosis factor related death ligand 1 antibody Tumor necrosis factor superfamily member 13 antibody TWE PRIL antibody UNQ383 antibody UNQ383/ PRO715 antibody ZTNF 2 antibody ZTNF2 antibody
Uniprot ID :
O75888
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
