product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-Ku70 Antibody
catalog :
PB9520
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-Ku70 Antibody
Catalog Number :
PB9520
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6(XRCC6) detection. Tested with WB, IHC-P in Human.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
Reference :
1. Baumann, P., West, S. C. DNA end-joining catalyzed by human cell-free extracts. Proc. Nat. Acad. Sci. 95: 14066- 14070, 1998.
2. Chan, J. Y. C., Lerman, M. I., Prabhakar, B. S., Isozaki, O., Santisteban, P., Kuppers, R. C., Oates, E. L., Notkins, A. L., Kohn, L. D. Cloning and characterization of a cDNA that encodes a 70-kDa novel human thyroid autoantigen. J. Biol. Chem. 264: 3651-3654, 1989.
Gene Name :
XRCC6
Protein Name :
X-ray repair cross-complementing protein 6
Gene Full Name :
X-ray repair complementing defective repair in Chinese hamster cells 6
Synonyms :
5''-deoxyribose-5-phosphate lyase Ku70 antibody 5''-dRP lyase Ku70 antibody 70 kDa subunit of Ku antigen antibody ATP dependent DNA helicase 2 subunit 1 antibody ATP dependent DNA helicase II 70 kDa subunit antibody ATP-dependent DNA helicase 2 subunit 1 antibody ATP-dependent DNA helicase II 70 kDa subunit antibody CTC box binding factor 75 kDa subunit antibody CTC box-binding factor 75 kDa subunit antibody CTC75 antibody CTCBF antibody DNA repair protein XRCC6 antibody G22P1 antibody Ku 70 antibody Ku autoantigen 70kDa antibody Ku autoantigen p70 subunit antibody Ku autoantigen, 70kDa antibody Ku p70 antibody Ku70 antibody Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa antibody Kup70 antibody Lupus Ku autoantigen protein p70 antibody ML8 antibody Thyroid autoantigen 70kD (Ku antigen) antibody Thyroid autoantigen antibody Thyroid lupus autoantigen antibody Thyroid lupus autoantigen p70 antibody Thyroid-lupus autoantigen antibody TLAA antibody X ray repair complementing defective repair in Chinese hamster cells 6 antibody X-ray repair complementing defective repair in Chinese hamster cells 6 antibody X-ray repair cross-complementing protein 6 antibody XRCC 6 antibody XRCC6 antibody XRCC6_HUMAN antibody
Uniprot ID :
P12956
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
