product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-TRAF6 Antibody
catalog :
PB9517
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-TRAF6 Antibody
Catalog Number :
PB9517
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for TNF receptor-associated factor 6(TRAF6) detection. Tested with WB in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human TRAF6 (99-130aa RDAGHKCPVDNEILLENQLFPDNFAKREILSL), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
TNF receptor-associated factor 6, also called E3 ubiquitin-protein ligase TRAF6 or RNF85, is a TRAF human protein. The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from, members of the TNF receptor superfamily. This gene is mapped to 11p12. And this protein mediates signaling from members of the TNF receptor superfamily as well as the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. Also this protein interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein.
Reference :
1. Akiyama, T., Maeda, S., Yamane, S., Ogino, K., Kasai, M., Kajiura, F., Matsumoto, M., Inoue, J. Dependence of self-tolerance on TRAF6-directed development of thymic stroma. Science 308: 248-251, 2005.
2. King, C. G., Kobayashi, T., Cejas, P. J., Kim, T., Yoon, K., Kim, G. K., Chiffoleau, E., Hickman, S. P., Walsh, P. T., Turka, L. A., Choi, Y. TRAF6 is a T cell-intrinsic negative regulator required for the maintenance of immune homeostasis. Nature Med. 12: 1088-1092, 2006.
Gene Name :
TRAF6
Protein Name :
TNF receptor-associated factor 6
Gene Full Name :
TNF receptor-associated factor 6, E3 ubiquitin protein ligase
Synonyms :
E3 ubiquitin-protein ligase TRAF6 antibody Interleukin 1 signal transducer antibody Interleukin-1 signal transducer antibody MGC 3310 antibody MGC:3310 antibody MGC3310 antibody OTTHUMP00000232772 antibody OTTHUMP00000232773 antibody RING finger protein 85 antibody RNF 85 antibody RNF85 antibody TNF receptor associated factor 6 antibody TNF receptor-associated factor 6 antibody TRAF 6 antibody Traf6 antibody TRAF6_HUMAN antibody
Uniprot ID :
Q9Y4K3
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
