Anti-TMEM173 Antibody | Boster Immunoleader PB9513 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-TMEM173 Antibody

catalog :

PB9513

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-TMEM173 Antibody

Catalog Number :

PB9513

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Stimulator of interferon genes protein (TMEM173) detection. Tested with WB, IHC-P in Human.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE), different from the related mouse sequence by five amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Transmembrane protein 173 is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.

Reference :

1. "Entrez Gene: Transmembrane protein 173". 2. Ishikawa, H; Barber, G. N. (2008). "STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling".Nature 455 (7213): 674–8. 3. Nazmi, A; Mukhopadhyay, R; Dutta, K; Basu, A (2012)."STING mediates neuronal innate immune response following Japanese encephalitis virus infection". Scientific Reports 2: 347.

Gene Name :

TMEM173

Protein Name :

Stimulator of interferon genes protein

Gene Full Name :

transmembrane protein 173

Synonyms :

endoplasmic reticulum IFN stimulator antibody Endoplasmic reticulum interferon stimulator antibody ERIS antibody FLJ38577 antibody hMITA antibody hSTING antibody Mediator of IRF3 activation antibody MITA antibody Mitochondrial mediator of IRF3 activation antibody MPYS antibody N terminal methionine proline tyrosine serine plasma membrane tetraspanner antibody NET23 antibody Stimulator of interferon genes antibody Stimulator of interferon genes protein antibody STING antibody TM173_HUMAN antibody Tmem173 antibody Transmembrane protein 173 antibody

Uniprot ID :

Q86WV6

more info or order :

Boster Immunoleader product webpage