product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-STAT1 Antibody
catalog :
PB9510
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-STAT1 Antibody
Catalog Number :
PB9510
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat
Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
The crystal structure of the DNA complex of a 67-kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution. Phosphorylation of Signal Transducer and Activator of transcription 1(STAT 1) was also decreased in rheumatoid arthritis lymphocytes. The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections. Activation of the signal transducers and activators of transcription (STAT) pathway is important in fibroblast growth factor (FGF) modulation of chondrocyte proliferation and endochondral bone formation during embryogenesis.
Reference :
1. Chapgier, A.; Boisson-Dupuis, S.; Jouanguy, E.; Vogt, G.; Feinberg, J.; Prochnicka-Chalufour, A.; Casrouge, A.; Yang, K.; Soudais, C.; Fieschi, C.; Santos, O. F.; Bustamante, J.; and 10 others : Novel STAT1 alleles in otherwise healthy patients with mycobacterial disease. PLoS Genet. 2: e131, 2006. Note: Electronic Article.
2. Ihle, J. N. : STATs: signal transducers and activators of transcription. Cell 84: 331-334, 1996.
3. Xiao, L.; Naganawa, T.; Obugunde, E.; Gronowicz, G.; Ornitz, D. M.; Coffin, J. D.; Hurley, M. M. : Stat1 controls postnatal bone formation by regulating fibroblast growth factor signaling in osteoblasts. J. Biol. Chem. 279: 27743-27752, 2004.
Gene Name :
STAT1
Protein Name :
Signal transducer and activator of transcription 1-alpha/beta
Gene Full Name :
signal transducer and activator of transcription 1, 91kDa
Synonyms :
Signal transducer and activator of transcription 1 91kD antibody DKFZp686B04100 antibody ISGF 3 antibody ISGF-3 antibody OTTHUMP00000163552 antibody OTTHUMP00000165046 antibody OTTHUMP00000165047 antibody OTTHUMP00000205845 antibody Signal transducer and activator of transcription 1 91kDa antibody Signal transducer and activator of transcription 1 alpha/ beta antibody Signal transducer and activator of transcription 1 antibody Signal transducer and activator of transcription 1, 91kD antibody Signal transducer and activator of transcription 1-alpha/beta antibody Signal Transductor and Activator of Transcription 1 antibody STAT 1 antibody STAT 91 antibody Stat1 antibody STAT1_HUMAN antibody STAT91 antibody Transcription factor ISGF 3 components p91 p84 antibody Transcription factor ISGF-3 components p91/p84 antibody
Uniprot ID :
P42224
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments