product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SOX5 Antibody
catalog :
PB9507
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-SOX5 Antibody
Catalog Number :
PB9507
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Reference :
1. "Entrez Gene: SOX5 SRY (sex determining region Y)-box 5".
2. Ikeda T; Zhang J; Chano T et al. (2003). "Identification and characterization of the human long form of Sox5 (L-SOX5) gene". Gene 298 (1): 59–68.
3. Wunderle VM, Critcher R, Ashworth A, Goodfellow PN (Jan 1997). "Cloning and characterization of SOX5, a new member of the human SOX gene family". Genomics 36 (2): 354–8.
Gene Name :
SOX5
Protein Name :
Transcription factor SOX-5
Gene Full Name :
SRY (sex determining region Y)-box 5
Synonyms :
L SOX5 antibody MGC35153 antibody Sex determining region Y box 5 antibody SOX 5 antibody SOX 5 protein antibody Sox5 antibody SOX5 protein antibody SOX5_HUMAN antibody SRY (sex determining region Y) box 5 antibody SRY box 5 antibody Transcription factor SOX 5 antibody Transcription factor SOX-5 antibody Transcription factor SOX5 antibody
Uniprot ID :
P35711
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
