Anti-SOX5 Antibody | Boster Immunoleader PB9507 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-SOX5 Antibody

catalog :

PB9507

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, rat

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-SOX5 Antibody

Catalog Number :

PB9507

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, rat

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Reference :

1. "Entrez Gene: SOX5 SRY (sex determining region Y)-box 5". 2. Ikeda T; Zhang J; Chano T et al. (2003). "Identification and characterization of the human long form of Sox5 (L-SOX5) gene". Gene 298 (1): 59–68. 3. Wunderle VM, Critcher R, Ashworth A, Goodfellow PN (Jan 1997). "Cloning and characterization of SOX5, a new member of the human SOX gene family". Genomics 36 (2): 354–8.

Gene Name :

SOX5

Protein Name :

Transcription factor SOX-5

Gene Full Name :

SRY (sex determining region Y)-box 5

Synonyms :

L SOX5 antibody MGC35153 antibody Sex determining region Y box 5 antibody SOX 5 antibody SOX 5 protein antibody Sox5 antibody SOX5 protein antibody SOX5_HUMAN antibody SRY (sex determining region Y) box 5 antibody SRY box 5 antibody Transcription factor SOX 5 antibody Transcription factor SOX-5 antibody Transcription factor SOX5 antibody

Uniprot ID :

P35711

more info or order :

Boster Immunoleader product webpage