product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SCARB1 Antibody
catalog :
PB9502
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
mouse, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-SCARB1 Antibody
Catalog Number :
PB9502
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1(SCARB1) detection. Tested with WB in Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.
Reference :
1. "Entrez Gene: SCARB1 Scavenger receptor class B, member 1".
2. Acton S, Rigotti A, Landschulz KT, Xu S, Hobbs HH, Krieger M (January 1996). "Identification of scavenger receptor SR-BI as a high density lipoprotein receptor".Science 271 (5248): 518–20.
3. Duggan AE, Marie RS, Callard IP (April 2002). "Expression of SR-BI (Scavenger Receptor Class B Type I) in turtle (Chrysemys picta) tissues and other nonmammalian vertebrates". J. Exp. Zool.292 (5): 430–4.
Gene Name :
SCARB1
Protein Name :
Scavenger receptor class B member 1
Gene Full Name :
scavenger receptor class B, member 1
Synonyms :
CD36 AND LIMPII ANALOGOUS 1 antibody CD36 antibody CD36 Antigen like 1 antibody CD36 antigen-like 1 antibody CD36L1 antibody CLA 1 antibody CLA-1 antibody CLA1 antibody Collagen type I receptor antibody HDLQTL6 antibody MGC138242 antibody SCARB1 antibody Scavebger Receptor Class B Member 1 antibody Scavenger receptor class B member 1 antibody Scavenger Receptor Class B Type 1 antibody SCRB1_HUMAN antibody SR BI antibody SR-BI antibody SRB1 antibody SRBI antibody Thrombospondin receptor like 1 antibody thrombospondin receptor-like 1 antibody
Uniprot ID :
Q61009
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
