Boster Immunoleader

antibody

Anti-SCARB1 Antibody

PB9502

100 ug/vial

240 USD

polyclonal

rabbit

mouse, rat

Anti-SCARB1 Antibody

PB9502

Polyclonal

Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1(SCARB1) detection. Tested with WB in Mouse;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: mouse, rat

WB

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.

1. "Entrez Gene: SCARB1 Scavenger receptor class B, member 1". 2. Acton S, Rigotti A, Landschulz KT, Xu S, Hobbs HH, Krieger M (January 1996). "Identification of scavenger receptor SR-BI as a high density lipoprotein receptor".Science 271 (5248): 518–20. 3. Duggan AE, Marie RS, Callard IP (April 2002). "Expression of SR-BI (Scavenger Receptor Class B Type I) in turtle (Chrysemys picta) tissues and other nonmammalian vertebrates". J. Exp. Zool.292 (5): 430–4.

SCARB1

Scavenger receptor class B member 1

scavenger receptor class B, member 1

CD36 AND LIMPII ANALOGOUS 1 antibody CD36 antibody CD36 Antigen like 1 antibody CD36 antigen-like 1 antibody CD36L1 antibody CLA 1 antibody CLA-1 antibody CLA1 antibody Collagen type I receptor antibody HDLQTL6 antibody MGC138242 antibody SCARB1 antibody Scavebger Receptor Class B Member 1 antibody Scavenger receptor class B member 1 antibody Scavenger Receptor Class B Type 1 antibody SCRB1_HUMAN antibody SR BI antibody SR-BI antibody SRB1 antibody SRBI antibody Thrombospondin receptor like 1 antibody thrombospondin receptor-like 1 antibody

Q61009