Anti-PKLR Antibody | Boster Immunoleader PB9499 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-PKLR Antibody

catalog :

PB9499

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-PKLR Antibody

Catalog Number :

PB9499

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR(PKLR) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human

Notes :

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.

Reference :

1. "Entrez Gene: PKLR pyruvate kinase, liver and RBC". 2. Tani K, Fujii H, Tsutsumi H, Sukegawa J, Toyoshima K, Yoshida MC, Noguchi T, Tanaka T, Miwa S (Apr 1987). "Human liver type pyruvate kinase: cDNA cloning and chromosomal assignment". Biochem Biophys Res Commun 143 (2): 431–8.

Gene Name :

PKLR

Protein Name :

Pyruvate kinase PKLR

Gene Full Name :

pyruvate kinase, liver and RBC

Synonyms :

EC 2.7.1.40 antibody KPYR_HUMAN antibody L-PK antibody Pk-1 antibody PK1 antibody PKL antibody Pklg antibody Pklr antibody PKR antibody PKRL antibody Pyruvate kinase 1 antibody Pyruvate kinase isozymes R/L antibody Pyruvate kinase liver and blood cell antibody Pyruvate kinase liver and RBC antibody Pyruvate kinase liver and red blood cell antibody Pyruvate kinase liver type antibody Pyruvate kinase type L antibody Pyruvate kinase, red cell type antibody R type/L type pyruvate kinase antibody R-PK antibody R-type/L-type pyruvate kinase antibody Red cell/liver pyruvate kinase antibody RPK antibody

Uniprot ID :

P30613

more info or order :

Boster Immunoleader product webpage