Boster Immunoleader

antibody

Anti-NQO1 Antibody

PB9497

100 ug/vial

240 USD

polyclonal

rabbit

human, rat

Anti-NQO1 Antibody

PB9497

Polyclonal

Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, rat

WB

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

1. "Entrez Gene: NQO1 NAD(P)H dehydrogenase, quinone 1". 2. Jaiswal AK (Nov 1991). "Human NAD(P)H:quinone oxidoreductase (NQO1) gene structure and induction by dioxin".Biochemistry x30 (44): 10647–53. 3. Ross D, Siegel D (2004). "NAD(P)H:quinone oxidoreductase 1 (NQO1, DT-diaphorase), functions and pharmacogenetics". Methods in Enzymology382: 115–44.

NQO1

NAD(P)H dehydrogenase [quinone] 1

NAD(P)H dehydrogenase, quinone 1

Azoreductase antibody Cytochrome b 5 reductase antibody DHQU antibody DIA 4 antibody DIA4 antibody Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody Diaphorase (NADH/NADPH) antibody Diaphorase 4 antibody Dioxin inducible 1 antibody DT diaphorase antibody DT-diaphorase antibody DTD antibody Menadione reductase antibody NAD(P)H dehydrogenase [quinone] 1 antibody NAD(P)H dehydrogenase quinone 1 antibody NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody NAD(P)H:menadione oxidoreductase 1 antibody NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody NAD(P)H:quinone oxidoreductase 1 antibody NAD(P)H:quinone oxireductase antibody NMOR 1 antibody NMOR I antibody NMOR1 antibody NMORI antibody NQO 1 antibody NQO1 antibody NQO1_HUMAN antibody Phylloquinone reductase antibody QR 1 antibody QR1 antibody Quinone reductase 1 antibody

P15559