product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-ICA1 Antibody
catalog :
PB9495
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
more info or order :
product information
Product Name :
Anti-ICA1 Antibody
Catalog Number :
PB9495
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: mouse, rat
Predicted to work with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human
Notes :
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What’s more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
Reference :
1. "Entrez Gene: ICA1 islet cell autoantigen 1, 69kDa".
2. Mally MI, Cirulli V, Hayek A, Otonkoski T (Sep 1996). "ICA69 is expressed equally in the human endocrine and exocrine pancreas". Diabetologia 39 (4): 474–80.
3. Miyazaki I, Gaedigk R, Hui MF, Cheung RK, Morkowski J, Rajotte RV, Dosch HM (Nov 1994). "Cloning of human and rat p69 cDNA, a candidate autoimmune target in type 1 diabetes".Biochim Biophys Acta 1227 (1–2): 101–4.
Gene Name :
ICA1
Protein Name :
Islet cell autoantigen 1
Gene Full Name :
islet cell autoantigen 1, 69kDa
Synonyms :
69 kDa islet cell autoantigen antibody Diabetes mellitus type I autoantigen antibody ICA 1 antibody Ica1 antibody ICA69 antibody ICA69_HUMAN antibody ICAp69 antibody Islet cell autoantigen 1 (69kD) antibody Islet cell autoantigen 1 69kDa antibody Islet cell autoantigen 1 antibody Islet cell autoantigen 1 isoform antibody Islet cell autoantigen p69 antibody OTTHUMP00000200933 antibody OTTHUMP00000200934 antibody OTTHUMP00000200941 antibody OTTHUMP00000200993 antibody p69 antibody
Uniprot ID :
Q05084
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments