Anti-ICA1 Antibody | Boster Immunoleader PB9495 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-ICA1 Antibody

catalog :

PB9495

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-ICA1 Antibody

Catalog Number :

PB9495

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: mouse, rat Predicted to work with: human

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Notes :

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What’s more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

Reference :

1. "Entrez Gene: ICA1 islet cell autoantigen 1, 69kDa". 2. Mally MI, Cirulli V, Hayek A, Otonkoski T (Sep 1996). "ICA69 is expressed equally in the human endocrine and exocrine pancreas". Diabetologia 39 (4): 474–80. 3. Miyazaki I, Gaedigk R, Hui MF, Cheung RK, Morkowski J, Rajotte RV, Dosch HM (Nov 1994). "Cloning of human and rat p69 cDNA, a candidate autoimmune target in type 1 diabetes".Biochim Biophys Acta 1227 (1–2): 101–4.

Gene Name :

ICA1

Protein Name :

Islet cell autoantigen 1

Gene Full Name :

islet cell autoantigen 1, 69kDa

Synonyms :

69 kDa islet cell autoantigen antibody Diabetes mellitus type I autoantigen antibody ICA 1 antibody Ica1 antibody ICA69 antibody ICA69_HUMAN antibody ICAp69 antibody Islet cell autoantigen 1 (69kD) antibody Islet cell autoantigen 1 69kDa antibody Islet cell autoantigen 1 antibody Islet cell autoantigen 1 isoform antibody Islet cell autoantigen p69 antibody OTTHUMP00000200933 antibody OTTHUMP00000200934 antibody OTTHUMP00000200941 antibody OTTHUMP00000200993 antibody p69 antibody

Uniprot ID :

Q05084

more info or order :

Boster Immunoleader product webpage