Boster Immunoleader

antibody

Anti-CPT1B Antibody

PB9491

100 ug/vial

240 USD

polyclonal

rabbit

human, mouse, rat

western blot, immunohistochemistry - paraffin section

Anti-CPT1B Antibody

PB9491

Polyclonal

Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, mouse, rat

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

1. Auinger A; Rubin D; Sabandal M; Helwig U; Rüther A; Schreiber S; Foelsch UR; Döring F; Schrezenmeir J. “A common haplotype of carnitine palmitoyltransferase 1b is associated with the metabolic syndrome”. Br J Nutr, 2013 Mar 14.

CPT1B

Carnitine O-palmitoyltransferase 1, muscle isoform

carnitine palmitoyltransferase 1B (muscle)

muscle isoform antibody Carnitine O palmitoyltransferase I mitochondrial muscle isoform antibody Carnitine O palmitoyltransferase I muscle isoform antibody Carnitine O-palmitoyl transferase 1, muscle isoform antibody Carnitine O-palmitoyltransferase I antibody Carnitine palmitoyltransferase 1A (muscle) antibody Carnitine palmitoyltransferase 1B (muscle) antibody Carnitine palmitoyltransferase 1B antibody Carnitine palmitoyltransferase I like protein antibody Carnitine palmitoyltransferase I muscle antibody Carnitine palmitoyltransferase I-like protein antibody CPT 1B antibody CPT I antibody CPT1 M antibody CPT1 muscle antibody CPT1-M antibody Cpt1b antibody CPT1B_HUMAN antibody CPT1M antibody CPTI antibody CPTI M antibody CPTI muscle antibody CPTI-M antibody CPTIM antibody FLJ55729 antibody FLJ58750 antibody KIAA1670 antibody M CPT1 antibody M-CPT1 antibody MCCPT1 antibody MCPT1 antibody muscle isoform antibody

Q92523