Anti-ATX2 Antibody | Boster Immunoleader PB9483 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-ATX2 Antibody

catalog :

PB9483

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-ATX2 Antibody

Catalog Number :

PB9483

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Ataxin-2(ATXN2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse; Predicted Species: Human

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Notes :

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

Reference :

1. Pulst, S.-M., Nechiporuk, A., Nechiporuk, T., Gispert, S., Chen, X.-N., Lopes-Cendes, I., Pearlman, S., Starkman, S., Orozco-Diaz, G., Lunkes, A., DeJong, P., Rouleau, G. A., Auburger, G., Korenberg, J. R., Figueroa, C., Sahba, S. Moderate expansion of a normally biallelic trinucleotide repeat in spinocerebellar ataxia type 2. 2. Ralser, M., Nonhoff, U., Albrecht, M., Lengauer, T., Wanker, E. E., Lehrach, H., Krobitsch, S. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Molec. Genet. 14: 2893-2909, 2005.

Gene Name :

ATXN2

Protein Name :

Ataxin-2

Gene Full Name :

ataxin 2

Synonyms :

Ataxin 2 antibody ATXN2 antibody Olivopontocerebellar ataxia 2, autosomal dominant antibody SCA2 antibody Spinocerebellar ataxia type 2 protein antibody TNRC13 antibody Trinucleotide repeat containing gene 13 protein antibody

Uniprot ID :

Q99700

more info or order :

Boster Immunoleader product webpage