product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-ATG14L Antibody
catalog :
PB9481
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-ATG14L Antibody
Catalog Number :
PB9481
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.
Reference :
1. Diao J; Liu R; Rong Y; Zhao M; Zhang J; Lai Y; Zhou Q; Wilz LM; Li J; Vivona S; Pfuetzner RA; Brunger AT; Zhong Q. “ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes”. Nature, 2015 Apr 23.
Gene Name :
ATG14
Protein Name :
Beclin 1-associated autophagy-related key regulator
Gene Full Name :
autophagy related 14
Synonyms :
4832427M01 antibody ATG14 antibody Atg14L antibody Autophagy-related protein 14-like protein antibody BAKOR_HUMAN antibody Barkor antibody Beclin 1-associated autophagy-related key regulator antibody D14Ertd114e antibody D14Ertd436e antibody KIAA0831 antibody mCG_6911 antibody
Uniprot ID :
Q6ZNE5
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments