Anti-ATG14L Antibody | Boster Immunoleader PB9481 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-ATG14L Antibody

catalog :

PB9481

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-ATG14L Antibody

Catalog Number :

PB9481

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P in Human;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Rat

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.

Reference :

1. Diao J; Liu R; Rong Y; Zhao M; Zhang J; Lai Y; Zhou Q; Wilz LM; Li J; Vivona S; Pfuetzner RA; Brunger AT; Zhong Q. “ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes”. Nature, 2015 Apr 23.

Gene Name :

ATG14

Protein Name :

Beclin 1-associated autophagy-related key regulator

Gene Full Name :

autophagy related 14

Synonyms :

4832427M01 antibody ATG14 antibody Atg14L antibody Autophagy-related protein 14-like protein antibody BAKOR_HUMAN antibody Barkor antibody Beclin 1-associated autophagy-related key regulator antibody D14Ertd114e antibody D14Ertd436e antibody KIAA0831 antibody mCG_6911 antibody

Uniprot ID :

Q6ZNE5

more info or order :

Boster Immunoleader product webpage