Anti-KIAA0652 Antibody | Boster Immunoleader PB9480 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-KIAA0652 Antibody

catalog :

PB9480

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-KIAA0652 Antibody

Catalog Number :

PB9480

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Autophagy-related protein 13(ATG13) detection. Tested with WB in Human;Mouse.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.

Reference :

1. "Entrez Gene: KIAA0652". 2. Chan EY, Longatti A, McKnight NC, Tooze SA (January 2009)."Kinase-Inactivated ULK Proteins Inhibit Autophagy via Their Conserved C-Terminal Domains Using an Atg13-Independent Mechanism". Mol. Cell. Biol. 29 (1): 157–71. 3. Hosokawa N, Hara T, Kaizuka T, Kishi C, Takamura A, Miura Y, Iemura S, Natsume T, Takehana K, Yamada N, Guan JL, Oshiro N, Mizushima N (April 2009). "Nutrient-dependent mTORC1 Association with the ULK1–Atg13–FIP200 Complex Required for Autophagy". Mol. Biol. Cell 20 (7): 1981–91. 4. Mercer CA, Kaliappan A, Dennis PB (July 2009). "A novel, human Atg13 binding protein, Atg101, interacts with ULK1 and is essential for macroautophagy". Autophagy 5 (5): 649–62.

Gene Name :

ATG13

Protein Name :

Autophagy-related protein 13

Gene Full Name :

autophagy related 13

Synonyms :

ATG13 antibody ATG13 autophagy related 13 homolog (S. cerevisiae) antibody ATG13_HUMAN antibody Autophagy related 13 antibody Autophagy related protein 13 antibody Autophagy-related protein 13 antibody FLJ20698 antibody KIAA0652 antibody OTTHUMP00000233321 antibody OTTHUMP00000233322 antibody OTTHUMP00000233323 antibody OTTHUMP00000233324 antibody OTTHUMP00000233325 antibody OTTHUMP00000233326 antibody

Uniprot ID :

O75143

more info or order :

Boster Immunoleader product webpage