product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-KIAA0652 Antibody
catalog :
PB9480
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse
application :
western blot
more info or order :
product information
Product Name :
Anti-KIAA0652 Antibody
Catalog Number :
PB9480
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Autophagy-related protein 13(ATG13) detection. Tested with WB in Human;Mouse.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Reference :
1. "Entrez Gene: KIAA0652".
2. Chan EY, Longatti A, McKnight NC, Tooze SA (January 2009)."Kinase-Inactivated ULK Proteins Inhibit Autophagy via Their Conserved C-Terminal Domains Using an Atg13-Independent Mechanism". Mol. Cell. Biol. 29 (1): 157–71.
3. Hosokawa N, Hara T, Kaizuka T, Kishi C, Takamura A, Miura Y, Iemura S, Natsume T, Takehana K, Yamada N, Guan JL, Oshiro N, Mizushima N (April 2009). "Nutrient-dependent mTORC1 Association with the ULK1–Atg13–FIP200 Complex Required for Autophagy". Mol. Biol. Cell 20 (7): 1981–91.
4. Mercer CA, Kaliappan A, Dennis PB (July 2009). "A novel, human Atg13 binding protein, Atg101, interacts with ULK1 and is essential for macroautophagy". Autophagy 5 (5): 649–62.
Gene Name :
ATG13
Protein Name :
Autophagy-related protein 13
Gene Full Name :
autophagy related 13
Synonyms :
ATG13 antibody ATG13 autophagy related 13 homolog (S. cerevisiae) antibody ATG13_HUMAN antibody Autophagy related 13 antibody Autophagy related protein 13 antibody Autophagy-related protein 13 antibody FLJ20698 antibody KIAA0652 antibody OTTHUMP00000233321 antibody OTTHUMP00000233322 antibody OTTHUMP00000233323 antibody OTTHUMP00000233324 antibody OTTHUMP00000233325 antibody OTTHUMP00000233326 antibody
Uniprot ID :
O75143
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
