Boster Immunoleader

antibody

Anti-ASPH Antibody

PB9478

100 ug/vial

240 USD

polyclonal

rabbit

human, mouse, rat

western blot, immunohistochemistry - paraffin section

Anti-ASPH Antibody

PB9478

Polyclonal

Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, mouse, rat

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Concentration: 0.5-1μg/ml; Tested Species: Human

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.

1. "Entrez Gene: ASPH aspartate beta-hydroxylase". 2. Korioth F, Gieffers C, Frey J (Feb 1995). "Cloning and characterization of the human gene encoding aspartyl beta-hydroxylase". Gene 150 (2): 395–9. 3. Lim KY, Hong CS, Kim DH (Nov 2000). "cDNA cloning and characterization of human cardiac junctin". Gene 255 (1): 35–42.

ASPH

Aspartyl/asparaginyl beta-hydroxylase

aspartate beta-hydroxylase

A beta H J J antibody AAH antibody ASP beta hydroxylase antibody Aspartyl/asparaginyl beta hydroxylase antibody ASPH antibody ASPH_HUMAN antibody BAH antibody Cardiac junctin antibody CASQ2BP1 antibody HAAH antibody Humbug antibody JCTN antibody junctin antibody Peptide aspartate beta dioxygenase antibody

Q12797