product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-ALDH2 Antibody
catalog :
PB9472
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
product information
Product Name :
Anti-ALDH2 Antibody
Catalog Number :
PB9472
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
Reference :
1. Chen, C.-H., Budas, G. R., Churchill, E. N., Disatnik, M.-H., Hurley, T. D., Mochly-Rosen, D. Activation of aldehyde dehydrogenase-2 reduces ischemic damage to the heart. Science 321: 1493-1495, 2008. 2. Goedde, H. W., Agarwal, D. P., Fritze, G., Meier-Tackmann, D., Singh, S., Beckmann, G., Bhatia, K., Chen, L. Z., Fang, B., Lisker, R., Paik, Y. K., Rothhammer, F., Saha, N., Segal, B., Srivastava, L. M., Czeizel, A. Distribution of ADH-2 and ALDH2 genotypes in different populations. Hum. Genet. 88: 344-346, 1992. 3. Hsu, L. C., Yoshida, A., Mohandas, T. Chromosomal assignment of the genes for human aldehyde dehydrogenase 1 (ALDH1) and aldehyde dehydrogenase 2 (ALDH2). (Abstract) Cytogenet. Cell Genet. 40: 656-657, 1985.
Gene Name :
ALDH2
Protein Name :
Aldehyde dehydrogenase, mitochondrial
Gene Full Name :
aldehyde dehydrogenase 2 family (mitochondrial)
Synonyms :
Acetaldehyde dehydrogenase 2 antibody Aldehyde dehydrogenase 2 family (mitochondrial) antibody Aldehyde dehydrogenase 2 family antibody Aldehyde dehydrogenase mitochondrial antibody Aldehyde dehydrogenase, mitochondrial antibody ALDH 2 antibody ALDH class 2 antibody ALDH E2 antibody ALDH-E2 antibody Aldh2 antibody ALDH2_HUMAN antibody ALDHI antibody ALDM antibody Liver mitochondrial ALDH antibody MGC1806 antibody Mitochondrial aldehyde dehydrogenase 2 antibody MS767 antibody Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody
Uniprot ID :
P05091
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits