Boster Immunoleader

antibody

Anti-ALDH2 Antibody

PB9472

100 ug/vial

240 USD

polyclonal

rabbit

human, mouse, rat

western blot, immunohistochemistry - paraffin section

Anti-ALDH2 Antibody

PB9472

Polyclonal

Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, mouse, rat

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Concentration: 0.5-1μg/ml; Tested Species: Human, Rat

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

1. Chen, C.-H., Budas, G. R., Churchill, E. N., Disatnik, M.-H., Hurley, T. D., Mochly-Rosen, D. Activation of aldehyde dehydrogenase-2 reduces ischemic damage to the heart. Science 321: 1493-1495, 2008. 2. Goedde, H. W., Agarwal, D. P., Fritze, G., Meier-Tackmann, D., Singh, S., Beckmann, G., Bhatia, K., Chen, L. Z., Fang, B., Lisker, R., Paik, Y. K., Rothhammer, F., Saha, N., Segal, B., Srivastava, L. M., Czeizel, A. Distribution of ADH-2 and ALDH2 genotypes in different populations. Hum. Genet. 88: 344-346, 1992. 3. Hsu, L. C., Yoshida, A., Mohandas, T. Chromosomal assignment of the genes for human aldehyde dehydrogenase 1 (ALDH1) and aldehyde dehydrogenase 2 (ALDH2). (Abstract) Cytogenet. Cell Genet. 40: 656-657, 1985.

ALDH2

Aldehyde dehydrogenase, mitochondrial

aldehyde dehydrogenase 2 family (mitochondrial)

Acetaldehyde dehydrogenase 2 antibody Aldehyde dehydrogenase 2 family (mitochondrial) antibody Aldehyde dehydrogenase 2 family antibody Aldehyde dehydrogenase mitochondrial antibody Aldehyde dehydrogenase, mitochondrial antibody ALDH 2 antibody ALDH class 2 antibody ALDH E2 antibody ALDH-E2 antibody Aldh2 antibody ALDH2_HUMAN antibody ALDHI antibody ALDM antibody Liver mitochondrial ALDH antibody MGC1806 antibody Mitochondrial aldehyde dehydrogenase 2 antibody MS767 antibody Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody

P05091