Anti-AGTR2 Antibody | Boster Immunoleader PB9471 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-AGTR2 Antibody

catalog :

PB9471

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, rat

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-AGTR2 Antibody

Catalog Number :

PB9471

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Type-2 angiotensin II receptor(AGTR2) detection. Tested with WB in Human;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, rat

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human AGTR2 (333-363aa FRVPITWLQGKRESMSCRKSSSLREMETFVS), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

AGTR2 is also known as angiotensin II receptor, type 2. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. The human AGTR2 gene is composed of three exons and spans at least 5 kb. Exons 1 and 2 encode for 5' untranslated mRNA sequence and exon 3 harbors the entire uninterrupted open reading frame.

Reference :

1. "Entrez Gene: AGTR2 angiotensin II receptor, type 2". 2. Ewert S, Laesser M, Johansson B, Holm M, Aneman A, Fandriks L (March 2003). "The angiotensin II receptor type 2 agonist CGP 42112A stimulates NO production in the porcine jejunal mucosa". BMC Pharmacol. 3: 2.

Gene Name :

AGTR2

Protein Name :

Type-2 angiotensin II receptor

Gene Full Name :

angiotensin II receptor, type 2

Synonyms :

AGTR 2 antibody Agtr2 antibody AGTR2_HUMAN antibody angiotensin II receptor type 2 antibody Angiotensin II type-2 receptor antibody Angiotensin receptor 2 antibody AT 2 antibody AT2 antibody ATGR 2 antibody ATGR2 antibody MRX 88 antibody MRX88 antibody Type 2 angiotensin II receptor antibody Type-2 angiotensin II receptor antibody

Uniprot ID :

P50052

more info or order :

Boster Immunoleader product webpage