product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-AGTR2 Antibody
catalog :
PB9471
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-AGTR2 Antibody
Catalog Number :
PB9471
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Type-2 angiotensin II receptor(AGTR2) detection. Tested with WB in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human AGTR2 (333-363aa FRVPITWLQGKRESMSCRKSSSLREMETFVS), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
AGTR2 is also known as angiotensin II receptor, type 2. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. The human AGTR2 gene is composed of three exons and spans at least 5 kb. Exons 1 and 2 encode for 5' untranslated mRNA sequence and exon 3 harbors the entire uninterrupted open reading frame.
Reference :
1. "Entrez Gene: AGTR2 angiotensin II receptor, type 2".
2. Ewert S, Laesser M, Johansson B, Holm M, Aneman A, Fandriks L (March 2003). "The angiotensin II receptor type 2 agonist CGP 42112A stimulates NO production in the porcine jejunal mucosa". BMC Pharmacol. 3: 2.
Gene Name :
AGTR2
Protein Name :
Type-2 angiotensin II receptor
Gene Full Name :
angiotensin II receptor, type 2
Synonyms :
AGTR 2 antibody Agtr2 antibody AGTR2_HUMAN antibody angiotensin II receptor type 2 antibody Angiotensin II type-2 receptor antibody Angiotensin receptor 2 antibody AT 2 antibody AT2 antibody ATGR 2 antibody ATGR2 antibody MRX 88 antibody MRX88 antibody Type 2 angiotensin II receptor antibody Type-2 angiotensin II receptor antibody
Uniprot ID :
P50052
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments