product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-ABCA1 Antibody
catalog :
PB9467
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-ABCA1 Antibody
Catalog Number :
PB9467
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family A member 1(ABCA1) detection. Tested with WB in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA1 (2231-2261aa KDLSLHKNQTVVDVAVLTSFLQDEKVKESYV), identical to the related mouse sequence.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
ABCA1 (ATP-binding cassette, sub-family A (ABC1), member 1), also known as ABC1, the cholesterol efflux regulatory protein (CERP) is a protein which in humans is encoded by the ABCA1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes contain 2,261 amino acids. Dot blot analysis of 50 tissues revealed ubiquitous expression of ABCA1 mRNA, with highest expression in placenta, liver, lung, adrenal glands, and all fetal tissues examined, and lowest expression in kidney, pancreas, pituitary, mammary gland, and bone marrow. This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterolefflux pump in the cellular lipid removal pathway. Using human ABCA1 expressed in the membrane fraction of sf9 insect cells, Szakacs et al. found specific, Mg(2+)-dependent ATP binding and low basal ATPase activity. Addition of potential lipid substrates or lipid acceptors did not modify the ATPase activity or nucleotide occlusion by ABCA1. Szakacs et al. speculated that ABCA1 may be a regulatory protein or may require other protein partners for full activation.
Reference :
1. Langmann, T., Klucken, J., Reil, M., Liebisch, G., Luciani, M.-F., Chimini, G., Kaminski, W. E., Schmitz, G. Molecular cloning of the human ATP-binding cassette transporter 1 (hABC1): evidence for sterol-dependent regulation in macrophages. Biochem. Biophys. Res. Commun. 257: 29-33, 1999.
2. Szakacs, G., Langmann, T., Ozvegy, C., Orso, E., Schmitz, G., Varadi, A., Sarkadi, B. Characterization of the ATPase cycle of human ABCA1: implications for its function as a regulator rather than an active transporter. Biochem. Biophys. Res. Commun. 288: 1258-1264, 2001.
Gene Name :
ABCA1
Protein Name :
ATP-binding cassette sub-family A member 1
Gene Full Name :
ATP-binding cassette, sub-family A (ABC1), member 1
Synonyms :
ABC 1 antibody ABC Transporter 1 antibody ABC-1 antibody ABC1 antibody ABCA 1 antibody ABCA1 antibody ABCA1_HUMAN antibody ATP binding Cassette 1 antibody ATP binding cassette sub family A ABC1 member 1 antibody ATP binding cassette sub family A member 1 antibody ATP binding Cassette Transporter 1 antibody ATP-binding cassette 1 antibody ATP-binding cassette sub-family A member 1 antibody ATP-binding cassette transporter 1 antibody
CERP antibody Cholesterol efflux regulatory protein antibody FLJ14958 antibody HDLDT1 antibody Membrane bound antibody MGC164864 antibody MGC165011 antibody TD antibody TGD antibody
Uniprot ID :
O95477
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments