Anti-Villin Antibody | Boster Immunoleader PB9457 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-Villin Antibody

catalog :

PB9457

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-Villin Antibody

Catalog Number :

PB9457

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Villin-1(VIL1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Notes :

WB: The detection limit for Villin is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Villin is known as VIL1. This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. In vertebrates, the villin proteins help to support the microfilaments of the microvilli of the brush border. It may play a role in cell plasticity through F-actin severing.

Reference :

1. Friederich, E; Vancompernolle, K; Louvard, D; Vandekerckhove, J (1999). "Villin function in the organization of the actin cytoskeleton. Correlation of in vivo effects to its biochemical activities in vitro". The Journal of Biological Chemistry274 (38): 26751–60. 2. Meng, J; Vardar, D; Wang, Y; Guo, HC; Head, JF; McKnight, CJ (2005). "High-resolution crystal structures of villin headpiece and mutants with reduced F-actin binding activity". Biochemistry 44 (36): 11963–73.

Gene Name :

VIL1

Protein Name :

Villin-1

Gene Full Name :

villin 1

Synonyms :

D2S1471 antibody OTTHUMP00000164145 antibody VIL antibody VIL1 antibody VILI_HUMAN antibody Villin 1 antibody Villin-1 antibody Villin1 antibody

Uniprot ID :

P09327

more info or order :

Boster Immunoleader product webpage