product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-TH Antibody
catalog :
PB9449
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-TH Antibody
Catalog Number :
PB9449
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Tyrosine 3-monooxygenase(TH) detection. Tested with WB, IHC-P in Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: mouse, rat
Predicted to work with: human
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human
Notes :
WB: The detection limit for TH is approximately 0.1ng/lane under reducing conditions.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human TH (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).
Reference :
1. Haavik J, Toska K (June 1998). "Tyrosine hydroxylase and Parkinson's disease". Mol. Neurobiol. 16 (3): 285–309.
2. Kaufman S (1995). "Tyrosine hydroxylase". Adv. Enzymol. Relat. Areas Mol. Biol. Advances in Enzymology - and Related Areas of Molecular Biology 70: 103–220.
Nagatsu T (1995). "Tyrosine hydroxylase: human isoforms, structure and regulation in physiology and pathology". Essays Biochem.30: 15–35.
Gene Name :
TH
Protein Name :
Tyrosine 3-monooxygenase
Gene Full Name :
tyrosine hydroxylase
Synonyms :
Dystonia 14 antibody DYT14 antibody DYT5b antibody EC 1.14.16.2 antibody OTTHUMP00000011225 antibody OTTHUMP00000011226 antibody ple antibody Protein Pale antibody TH antibody The antibody TY3H_HUMAN antibody TYH antibody Tyrosine 3 hydroxylase antibody Tyrosine 3 monooxygenase antibody Tyrosine 3-hydroxylase antibody Tyrosine 3-monooxygenase antibody Tyrosine hydroxylase antibody
Uniprot ID :
P07101
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
