Anti-Sp5 Antibody | Boster Immunoleader PB9443 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-Sp5 Antibody

catalog :

PB9443

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-Sp5 Antibody

Catalog Number :

PB9443

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human

Notes :

WB: The detection limit for Sp5 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

Reference :

1. Chen Y; Guo Y; Ge X; Itoh H; Watanabe A; Fujiwara T; Kodama T; Aburatani H: Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers. Biochem Biophys Res Commun, 2006 Feb 17. 2. Simmons SO; Horowitz JM: Nkx3.1 binds and negatively regulates the transcriptional activity of Sp-family members in prostate-derived cells. Biochem J, 2006 Jan 1.

Gene Name :

SP5

Protein Name :

Transcription factor Sp5

Gene Full Name :

Sp5 transcription factor

Synonyms :

Transcription factor Sp5 antibody

Uniprot ID :

Q6BEB4

more info or order :

Boster Immunoleader product webpage