product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SOD2 Antibody
catalog :
PB9442
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-SOD2 Antibody
Catalog Number :
PB9442
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P in Human;Mouse.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human
Notes :
WB: The detection limit for SOD2 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
SOD2(Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.
Reference :
1. Bastaki, M., Huen, K., Manzanillo, P., Chande, N., Chen, C., Balmes, J. R., Tager, I. B., Holland, N. Genotype-activity relationship for Mn-superoxide dismutase, glutathione peroxidase 1 and catalase in humans. Pharmacogenet. Genomics 16: 279-286, 2006.
2. Creagan, R., Tischfield, J., Ricciuti, F., Ruddle, F. H. Chromosome assignments of genes in man using mouse-human somatic cell hybrids: mitochondrial superoxide dismutase (indophenol oxidase-B, tetrameric) to chromosome 6. Humangenetik 20: 203-209, 1973.
3. Hiroi, S., Harada, H., Nishi, H., Satoh, M., Nagai, R., Kimura, A. Polymorphisms in the SOD2 and HLA-DRB1 genes are associated with nonfamilial idiopathic dilated cardiomyopathy in Japanese. Biochem. Biophys. Res. Commun. 261: 332-339, 1999.
Gene Name :
SOD2
Protein Name :
Superoxide dismutase [Mn], mitochondrial
Gene Full Name :
superoxide dismutase 2, mitochondrial
Synonyms :
Indophenoloxidase B antibody IPO B antibody IPOB antibody Manganese containing superoxide dismutase antibody Manganese SOD antibody Manganese superoxide dismutase antibody Mangano superoxide dismutase antibody Mn SOD antibody Mn superoxide dismutase antibody MNSOD antibody MVCD6 antibody SOD 2 antibody SOD-2 antibody SOD2 antibody SODM_HUMAN antibody Superoxide dismutase [Mn] mitochondrial antibody Superoxide dismutase [Mn] mitochondrial precursor antibody Superoxide dismutase [Mn], mitochondrial antibody Superoxide dismutase 2 mitochondrial antibody
Uniprot ID :
P04179
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
