Anti-SLUG Antibody | Boster Immunoleader PB9439 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-SLUG Antibody

catalog :

PB9439

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-SLUG Antibody

Catalog Number :

PB9439

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Zinc finger protein SNAI2(SNAI2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Notes :

WB: The detection limit for SLUG is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

Reference :

1. "Entrez Gene: SNAI2 snail homolog 2 (Drosophila) 2. Cohen ME, Yin M, Paznekas WA, Schertzer M, Wood S, Jabs EW (Oct 1998). "Human SLUG gene organization, expression, and chromosome map location on 8q". Genomics 51 (3): 468–71. 3. Rhim H, Savagner P, Thibaudeau G, Thiery JP, Pavan WJ (Jan 1998). "Localization of a neural crest transcription factor, Slug, to mouse chromosome 16 and human chromosome 8". Mamm Genome 8 (11): 872–3.

Gene Name :

SNAI2

Protein Name :

Zinc finger protein SNAI2

Gene Full Name :

snail family zinc finger 2

Synonyms :

MGC10182 antibody Neural crest transcription factor Slug antibody Protein snail homolog 2 antibody Slug (chicken homolog) zinc finger protein antibody Slug homolog zinc finger protein antibody Slug zinc finger protein antibody SLUGH 1 antibody SLUGH antibody SLUGH1 antibody SNAI 2 antibody SNAI2 antibody SNAI2_HUMAN antibody Snail 2 antibody Snail homolog 2 antibody Snail2 antibody WS 2D antibody WS2D antibody Zinc finger protein SLUG antibody Zinc finger protein SNAI2 antibody

Uniprot ID :

O43623

more info or order :

Boster Immunoleader product webpage