product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SLUG Antibody
catalog :
PB9439
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-SLUG Antibody
Catalog Number :
PB9439
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Zinc finger protein SNAI2(SNAI2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human
Notes :
WB: The detection limit for SLUG is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Reference :
1. "Entrez Gene: SNAI2 snail homolog 2 (Drosophila)
2. Cohen ME, Yin M, Paznekas WA, Schertzer M, Wood S, Jabs EW (Oct 1998). "Human SLUG gene organization, expression, and chromosome map location on 8q". Genomics 51 (3): 468–71.
3. Rhim H, Savagner P, Thibaudeau G, Thiery JP, Pavan WJ (Jan 1998). "Localization of a neural crest transcription factor, Slug, to mouse chromosome 16 and human chromosome 8". Mamm Genome 8 (11): 872–3.
Gene Name :
SNAI2
Protein Name :
Zinc finger protein SNAI2
Gene Full Name :
snail family zinc finger 2
Synonyms :
MGC10182 antibody Neural crest transcription factor Slug antibody Protein snail homolog 2 antibody Slug (chicken homolog) zinc finger protein antibody Slug homolog zinc finger protein antibody Slug zinc finger protein antibody SLUGH 1 antibody SLUGH antibody SLUGH1 antibody SNAI 2 antibody SNAI2 antibody SNAI2_HUMAN antibody Snail 2 antibody Snail homolog 2 antibody Snail2 antibody WS 2D antibody WS2D antibody Zinc finger protein SLUG antibody Zinc finger protein SNAI2 antibody
Uniprot ID :
O43623
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
