product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-Heparanase 1 Antibody
catalog :
PB9427
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-Heparanase 1 Antibody
Catalog Number :
PB9427
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Notes :
WB: The detection limit for Heparanase 1 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.
Reference :
1. Hulett MD, Freeman C, Hamdorf BJ, Baker RT, Harris MJ, Parish CR (July 1999), "Cloning of mammalian heparanase, an important enzyme in tumor invasion and metastasis", Nature medicine 5 (7): 803–9.
2. Nakajima M, Irimura T, Nicolson GL. (1988), "Heparanases and tumor metastasis", J. Cell. Biochem. 36 (2): 157–167.
3. Toyoshima, M.; Nakajima, M. : Human heparanase: purification, characterization, cloning, and expression. J. Biol. Chem. 274: 24153-24160, 1999.
4. Vlodavsky I, Friedmann Y, Elkin M, Aingorn H, Atzmon R, Ishai-Michaeli R, Bitan M, Pappo O, Peretz T, Michal I, Spector L, Pecker I (July 1999), "Mammalian heparanase: gene cloning, expression and function in tumor progression and metastasis", Nature medicine 5 (7): 793–802.
5. Vlodavsky I, Goldshmidt O, Zcharia E, et al. (2003), "Mammalian heparanase: involvement in cancer metastasis, angiogenesis and normal development.", Semin. Cancer Biol. 12 (2): 121–9.
Gene Name :
HPSE
Protein Name :
Heparanase
Gene Full Name :
heparanase
Synonyms :
Endo glucoronidase antibody Endo-glucoronidase antibody HEP antibody Heparanase 50 kDa subunit antibody Heparanase antibody Heparanase-1 antibody Heparanase1 antibody Hpa 1 antibody HPA antibody Hpa1 antibody HPR 1 antibody HPR1 antibody HPSE 1 antibody HPSE antibody HPSE_HUMAN antibody HPSE1 antibody HSE 1 antibody HSE1 antibody
Uniprot ID :
Q9Y251
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
