Boster Immunoleader

antibody

Anti-Heparanase 1 Antibody

PB9427

100 ug/vial

240 USD

polyclonal

rabbit

human, rat

Anti-Heparanase 1 Antibody

PB9427

Polyclonal

Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, rat

WB

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

WB: The detection limit for Heparanase 1 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.

1. Hulett MD, Freeman C, Hamdorf BJ, Baker RT, Harris MJ, Parish CR (July 1999), "Cloning of mammalian heparanase, an important enzyme in tumor invasion and metastasis", Nature medicine 5 (7): 803–9. 2. Nakajima M, Irimura T, Nicolson GL. (1988), "Heparanases and tumor metastasis", J. Cell. Biochem. 36 (2): 157–167. 3. Toyoshima, M.; Nakajima, M. : Human heparanase: purification, characterization, cloning, and expression. J. Biol. Chem. 274: 24153-24160, 1999. 4. Vlodavsky I, Friedmann Y, Elkin M, Aingorn H, Atzmon R, Ishai-Michaeli R, Bitan M, Pappo O, Peretz T, Michal I, Spector L, Pecker I (July 1999), "Mammalian heparanase: gene cloning, expression and function in tumor progression and metastasis", Nature medicine 5 (7): 793–802. 5. Vlodavsky I, Goldshmidt O, Zcharia E, et al. (2003), "Mammalian heparanase: involvement in cancer metastasis, angiogenesis and normal development.", Semin. Cancer Biol. 12 (2): 121–9.

HPSE

Heparanase

heparanase

Endo glucoronidase antibody Endo-glucoronidase antibody HEP antibody Heparanase 50 kDa subunit antibody Heparanase antibody Heparanase-1 antibody Heparanase1 antibody Hpa 1 antibody HPA antibody Hpa1 antibody HPR 1 antibody HPR1 antibody HPSE 1 antibody HPSE antibody HPSE_HUMAN antibody HPSE1 antibody HSE 1 antibody HSE1 antibody

Q9Y251