product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-APH1a Antibody
catalog :
PB9421
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse
application :
western blot
more info or order :
product information
Product Name :
Anti-APH1a Antibody
Catalog Number :
PB9421
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1(APH1A) detection. Tested with WB in Human;Mouse.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse
Notes :
WB: The detection limit for APH1a is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.
Reference :
1. Qin W; Jia L; Zhou A; Zuo X; Cheng Z; Wang F; Shi F; Jia J: The -980C/G polymorphism in APH-1A promoter confers risk of Alzheimer's disease. Aging Cell, 2011 Aug.
Gene Name :
APH1A
Protein Name :
Gamma-secretase subunit APH-1
Gene Full Name :
APH1A gamma secretase subunit
Synonyms :
6530402N02Rik antibody AL138795.3 antibody Anterior Pharynx Defective 1 antibody Anterior pharynx defective 1 homolog A antibody APH 1A antibody Aph 1alpha antibody APH-1a antibody Aph-1alpha antibody Aph1a antibody APH1A gamma secretase subunit antibody APH1A_HUMAN antibody CGI 78 antibody CGI78 antibody Gamma secretase subunit APH 1A antibody Gamma Secretase Subunit APH1a antibody Gamma-secretase subunit APH-1A antibody Likely ortholog of C. elegans anterior pharynx defective 1A antibody Presenilin Stabilization Factor antibody Presenilin-stabilization factor antibody PSF antibody UNQ579/PRO1141 antibody
Uniprot ID :
Q96BI3
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
