product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-STAT6 Antibody
catalog :
PB9405
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-STAT6 Antibody
Catalog Number :
PB9405
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 6(STAT6) detection. Tested with WB in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: rat
Predicted to work with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Rat; Predicted Species: Human
Notes :
WB: The detection limit for STAT6 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
Reference :
1. Dickensheets, H. L., Venkataraman, C., Schindler, U., Donnelly, R. P.Interferons inhibit activation of STAT6 by interleukin 4 in human monocytes by inducing SOCS-1 gene expression.Proc. Nat. Acad. Sci. 96: 10800-10805, 1999.
2. Duetsch, G., Illig, T., Loesgen, S., Rohde, K., Kloop, N., Herbon, N., Cohlke, H., Altmueller, J., Wjst, M.STAT6 as an asthma candidate gene: polymorphism-screening, association and haplotype analysis in a Caucasian sib-pair study.Hum. Molec. Genet. 11: 613-621, 2002.
3. Mullings, R. E., Wilson, S. J., Puddicombe, S. M., Lordan, J. L., Bucchieri, F., Djukanovic, R., Howarth, P. H., Harper, S., Holgate, S. T., Davies, D. E.Signal transducer and activator of transcription 6 (STAT-6) expression and function in asthmatic bronchial epithelium.J. Allergy Clin. Immun. 108: 832-838, 2001.
Gene Name :
STAT6
Protein Name :
Signal transducer and activator of transcription 6
Gene Full Name :
signal transducer and activator of transcription 6, interleukin-4 induced
Synonyms :
D12S1644 antibody IL 4 STAT antibody IL-4 Stat antibody IL4 STAT antibody Interleukin 4 Induced antibody Interleukin 4 Induced Transcription Factor IL4 STAT antibody Signal transducer and activator of transcription 6 antibody Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced antibody Signal Transducer And Activator Of Transcription 6 Nirs Variant 1 antibody Signal transducer and activator of transcription 6, interleukin 4 induced antibody STAT 6 antibody STAT interleukin4 induced antibody STAT, interleukin4 induced antibody Stat6 antibody STAT6_HUMAN antibody STAT6B antibody STAT6C antibody Transcription factor IL 4 STAT antibody
Uniprot ID :
P42226
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
