product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SMAD1/2/3/4/5 Antibody
catalog :
PB9395
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot
product information
Product Name :
Anti-SMAD1/2/3/4/5 Antibody
Catalog Number :
PB9395
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Mothers against decapentaplegic homolog 1/2/3/4/5(SMAD1/2/3/4/5) detection. Tested with WB in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
WB: The detection limit for SMAD1/2/3/4/5 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human SMAD1/2/3/4/5 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-β superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
Reference :
1. Zhu, H., Kavsak, P., Abdollah, S., Wrana, J. L., Thomsen, G. H. A SMAD ubiquitin ligase targets the BMP pathway and affects embryonic pattern formation. Nature 400: 687-693, 1999.
Gene Name :
SMAD1/2/3/4/5
Protein Name :
Mothers against decapentaplegic homolog 1/2/3/4/5
Gene Full Name :
SMAD family member 1/2/3/4/5
Synonyms :
BSP 1 antibody DwfA antibody hSMAD1 antibody JV41 antibody MAD homolog 1 antibody Mad-related protein 1 antibody Smad1 antibody hMAD 2 antibody JV18 antibody MAD homolog 2 antibody SMAD 2 antibody hMAD 3 antibody JV15 2 antibody MAD3 antibody SMAD 3 antibody hSMAD4 antibody MADH 4 antibody SMAD4 antibody JV5 1 antibody Dwfc antibody SMAD 5 antibody
Uniprot ID :
Q15797
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits