Anti-SMAD1/2/3/4/5 Antibody | Boster Immunoleader PB9395 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-SMAD1/2/3/4/5 Antibody

catalog :

PB9395

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-SMAD1/2/3/4/5 Antibody

Catalog Number :

PB9395

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Mothers against decapentaplegic homolog 1/2/3/4/5(SMAD1/2/3/4/5) detection. Tested with WB in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Notes :

WB: The detection limit for SMAD1/2/3/4/5 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human SMAD1/2/3/4/5 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-β superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.

Reference :

1. Zhu, H., Kavsak, P., Abdollah, S., Wrana, J. L., Thomsen, G. H. A SMAD ubiquitin ligase targets the BMP pathway and affects embryonic pattern formation. Nature 400: 687-693, 1999.

Gene Name :

SMAD1/2/3/4/5

Protein Name :

Mothers against decapentaplegic homolog 1/2/3/4/5

Gene Full Name :

SMAD family member 1/2/3/4/5

Synonyms :

BSP 1 antibody DwfA antibody hSMAD1 antibody JV41 antibody MAD homolog 1 antibody Mad-related protein 1 antibody Smad1 antibody hMAD 2 antibody JV18 antibody MAD homolog 2 antibody SMAD 2 antibody hMAD 3 antibody JV15 2 antibody MAD3 antibody SMAD 3 antibody hSMAD4 antibody MADH 4 antibody SMAD4 antibody JV5 1 antibody Dwfc antibody SMAD 5 antibody

Uniprot ID :

Q15797

more info or order :

Boster Immunoleader product webpage