product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SLC22A2 Antibody
catalog :
PB9394
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-SLC22A2 Antibody
Catalog Number :
PB9394
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: mouse, rat
Predicted to work with: human
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human
Notes :
WB: The detection limit for SLC22A2 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.
Reference :
1. "Entrez Gene: SLC22A2 solute carrier family 22 (organic cation transporter), member 2".
2. Koehler, M. R., Wissinger, B., Gorboulev, V., Koepsell, H., Schmid, M. The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26. Cytogenet. Cell Genet. 79: 198-200, 1997.
Gene Name :
SLC22A2
Protein Name :
Solute carrier family 22 member 2
Gene Full Name :
solute carrier family 22 (organic cation transporter), member 2
Synonyms :
MGC32628 antibody OCT 2 antibody OCT2 antibody Organic cation transporter 2 antibody Organic cation transporter antibody RP11-317M22.2 antibody Solute carrier family 22 (organic cation transporter) member 2 antibody Solute carrier family 22 member 2 antibody
Uniprot ID :
O15244
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
