Anti-SLC22A2 Antibody | Boster Immunoleader PB9394 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-SLC22A2 Antibody

catalog :

PB9394

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-SLC22A2 Antibody

Catalog Number :

PB9394

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: mouse, rat Predicted to work with: human

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Notes :

WB: The detection limit for SLC22A2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Reference :

1. "Entrez Gene: SLC22A2 solute carrier family 22 (organic cation transporter), member 2". 2. Koehler, M. R., Wissinger, B., Gorboulev, V., Koepsell, H., Schmid, M. The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26. Cytogenet. Cell Genet. 79: 198-200, 1997.

Gene Name :

SLC22A2

Protein Name :

Solute carrier family 22 member 2

Gene Full Name :

solute carrier family 22 (organic cation transporter), member 2

Synonyms :

MGC32628 antibody OCT 2 antibody OCT2 antibody Organic cation transporter 2 antibody Organic cation transporter antibody RP11-317M22.2 antibody Solute carrier family 22 (organic cation transporter) member 2 antibody Solute carrier family 22 member 2 antibody

Uniprot ID :

O15244

more info or order :

Boster Immunoleader product webpage