product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SFTPA1/2 Antibody
catalog :
PB9390
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
product information
Availability :
info changed 20150601
Product Name :
Anti-SFTPA1/2 Antibody
Catalog Number :
PB9390
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P,IHC-F
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat
Immunohistochemistry(Frozen Section) :
Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat
Notes :
WB: The detection limit for SFTPA1/2 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human
SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P) and ICC.
Background :
SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.
Reference :
1. Perez-Gil J, Weaver TE (June 2010). "Pulmonary surfactant pathophysiology: current models and open questions".Physiology (Bethesda) 25 (3): 132–41.
2. Phelps DS (2001). "Surfactant regulation of host defense function in the lung: a question of balance". Pediatr Pathol Mol Med 20 (4): 269–92.
Gene Name :
SFTPA1/2
Protein Name :
Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2
Gene Full Name :
surfactant protein A1/surfactant protein A2
Synonyms :
35 kDa pulmonary surfactant associated protein antibody 35 kDa pulmonary surfactant-associated protein antibody Alveolar proteinosis protein antibody COLEC4 antibody Collectin 4 antibody Collectin-4 antibody FLJ50593 antibody FLJ51913 antibody FLJ61144 antibody FLJ77898, antibody FLJ79095 antibody FLJ99559 antibody MGC133365 antibody MGC198590 antibody OTTHUMP00000019928 antibody OTTHUMP00000019929 antibody OTTHUMP00000019930 antibody OTTHUMP00000019931 antibody PSAP antibody PSP A antibody PSP-A antibody PSPA antibody pulmonary surfactant -associated protein, 35-KD antibody pulmonary surfactant apoprotein PSP-A antibody pulmonary surfactant associated protein A1 antibody Pulmonary surfactant-associated protein A1 antibody SFTA1_HUMAN antibody SFTP1 antibody SFTPA1 antibody SFTPA1B antibody SP A antibody SP A1 antibody SP-A antibody SP-A1 antibody SPA antibody SPA1 antibody surfactant protein A1 antibody surfactant protein A1 variant AB'D' 6A2 antibody surfactant protein A1 variant AB'D' 6A3 antibody surfactant protein A1 variant AB'D' 6A4 antibody surfactant protein A1 variant ACD' 6A2 antibody surfactant protein A1 variant ACD' 6A3 antibody surfactant protein A1 variant ACD' 6A4 antibody surfactant protein A1 variant AD' 6A antibody surfactant protein A1 variant AD' 6A2 antibody surfactant protein A1 variant AD' 6A3 antibody surfactant protein A1 variant AD' 6A4 antibody surfactant protein A1B antibody surfactant, pulmonary associated protein A1A antibody surfactant, pulmonary associated protein A1B antibody surfactant-associated protein, pulmonary 1 antibody
Uniprot ID :
Q8IWL1/Q8IWL2
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
