product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-Peroxiredoxin 4 Antibody
catalog :
PB9383
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-Peroxiredoxin 4 Antibody
Catalog Number :
PB9383
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Peroxiredoxin-4(PRDX4) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P,ICC
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat
Immunocytochemistry :
Concentration: 0.5-1μg/ml; Tested Species: Human
Notes :
WB: The detection limit for Peroxiredoxin 4 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P) and ICC.
Background :
PRDX4 (peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.
Reference :
1. Jin, D.-Y, Chae, H. Z, Rhee, S. G, Jeang, K.-T. Regulatory role for a novel human thioredoxin peroxidase in NF-kappa-B activation. J. Biol. Chem. 272: 30952-30961, 1997.
Gene Name :
PRDX4
Protein Name :
Peroxiredoxin-4
Gene Full Name :
peroxiredoxin 4
Synonyms :
Antioxidant enzyme 372 antibody Antioxidant enzyme AOE372 antibody AOE37 2 antibody AOE37-2 antibody AOE372 antibody EC 1.11.1.15 antibody Peroxiredoxin IV antibody Peroxiredoxin-4 antibody Peroxiredoxin4 antibody PRDX 4 antibody PRDX4 antibody PRDX4_HUMAN antibody PRX 4 antibody Prx IV antibody Prx-IV antibody PRX4 antibody PrxIV antibody Thioredoxin dependent peroxide reductase A0372 antibody Thioredoxin Peroxidase (Antioxidant Enzyme) antibody Thioredoxin peroxidase antibody Thioredoxin peroxidase AO372 antibody Thioredoxin-dependent peroxide reductase A0372 antibody TRANK antibody
Uniprot ID :
Q13162
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
