product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-PLN Antibody
catalog :
PB9381
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
more info or order :
product information
Product Name :
Anti-PLN Antibody
Catalog Number :
PB9381
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Cardiac phospholamban(PLN) detection. Tested with WB in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
WB: The detection limit for PLN is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells. It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, with markedly lower expression observed in smooth muscles, while the right atrium also expressed low levels of phospholamban. The structure of the human phospholamban gene closely resembles that reported for chicken, rabbit, rat, and mouse. Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site.
Reference :
1. Rodriguez P, Kranias EG (December 2005). "Phospholamban: a key determinant of cardiac function and dysfunction". Arch Mal Coeur Vaiss 98 (12): 1239–43.
2. McTiernan, C. F.; Frye, C. S.; Lemster, B. H.; Kinder, E. A.; Ogletree-Hughes, M. L.; Moravec, C. S.; Feldman, A. M. : The human phospholamban gene: structure and expression. J. Molec. Cell Cardiol. 31: 679-692, 1999.
Gene Name :
PLN
Protein Name :
Cardiac phospholamban
Gene Full Name :
phospholamban
Synonyms :
Cardiac phospholamban antibody CMD1P antibody CMH18 antibody PLB antibody PLN antibody PPLA_HUMAN antibody
Uniprot ID :
P26678
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments