Anti-CD36 Antibody | Boster Immunoleader PB9371 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-CD36 Antibody

catalog :

PB9371

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-CD36 Antibody

Catalog Number :

PB9371

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Rat

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.

Reference :

1. Tandon NN, Kralisz U, Jamieson GA (5 May 1989). "Identification of glycoprotein IV (CD36) as a primary receptor for platelet-collagen adhesion". J. Biol. Chem. 264 (13): 7576–83. PMID 2468670. 2. Jump up ^ Silverstein RL, Baird M, Lo SK, Yesner LM (15 August 1992). "Sense and antisense cDNA transfection of CD36 (glycoprotein IV) in melanoma cells. Role of CD36 as a thrombospondin receptor". J. Biol. Chem. 267 (23): 16607–12. PMID 1379600. 3. Kuda O, Pietka TA, Demianova Z, Kudova E, Cvacka J, Kopecky J, Abumrad NA (May 2013). "Sulfo-N-succinimidyl Oleate (SSO) Inhibits Fatty Acid Uptake and Signaling for Intracellular Calcium via Binding CD36 Lysine 164: SSO ALSO INHIBITS OXIDIZED LOW DENSITY LIPOPROTEIN UPTAKE BY MACROPHAGES.". J. Biol. Chem. 288 (22): 15547–55. doi:10.1074/jbc.M113.473298.PMID 23603908.

Gene Name :

CD36

Protein Name :

Platelet glycoprotein 4

Gene Full Name :

CD36 molecule (thrombospondin receptor)

Synonyms :

Adipocyte membrane protein antibody CD36 antibody CD36 antibody CD36 antigen (collagen type I receptor, thrombospondin receptor) antibody CD36 antigen antibody CD36 molecule (thrombospondin receptor) antibody CD36 molecule antibody CD36_HUMAN antibody CHDS7 antibody Cluster determinant 36 antibody Collagen receptor, platelet antibody FAT antibody Fatty acid translocase antibody Fatty acid transport protein antibody Glycoprotein IIIb antibody GP IIIb antibody GP3B antibody GP4 antibody GPIIIB antibody GPIV antibody Leukocyte differentiation antigen CD36 antibody MGC108510 antibody MGC91634 antibody PAS 4 protein antibody PAS IV antibody PAS-4 antibody PASIV antibody Platelet collagen receptor antibody Platelet glycoprotein 4 antibody Platelet glycoprotein IV antibody scarb3 antibody Scavenger receptor class B member 3 antibody Thrombospondin receptor antibody

Uniprot ID :

P16671

more info or order :

Boster Immunoleader product webpage