product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-Caspase-2 Antibody
catalog :
PB9368
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot
product information
Product Name :
Anti-Caspase-2 Antibody
Catalog Number :
PB9368
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Caspase-2(CASP2) detection. Tested with WB in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Caspase-2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
CASP2 is equal to Caspase-2. And Caspase-2, which is involved in stress-induced apoptosis, is recruited into a large protein complex, the molecular composition of which remains elusive. It is showed that activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD. Increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli. Caspase-2 acts both as a positive and negative cell death effector, depending upon cell lineage and stage of development.
Reference :
1. Bergeron, L.; Perez, G. I.; Macdonald, G.; Shi, L.; Sun, Y.; Jurisicova, A.; Varmuza, S.; Latham, K. E.; Flaws, J. A.; Salter, J. C. M.; Hara, H.; Moskowitz, M. A.; Li, E.; Greenberg, A.; Tilly, J. L.; Yuan, J. : Defects in regulation of apoptosis in caspase-2-deficient mice. Genes Dev. 12: 1304-1314, 1998. 2. Tinel, A.; Tschopp, J. : The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. Science 304: 843-846, 2004.
Gene Name :
CASP2
Protein Name :
Caspase-2
Gene Full Name :
caspase 2, apoptosis-related cysteine peptidase
Synonyms :
CASP 2 antibody CASP-2 antibody Casp2 antibody CASP2_HUMAN antibody Caspase 2 antibody Caspase 2 apoptosis related cysteine peptidase antibody Caspase-2 subunit p12 antibody Caspase2 antibody ICH 1 antibody ICH 1 protease antibody ICH 1L antibody ICH1 antibody ICH1 protease antibody ICH1L antibody NEDD-2 antibody NEDD2 antibody Neural precursor cell expressed developmentally down-regulated protein 2 antibody PPP1R57 antibody Protease ICH-1 antibody Protein phosphatase 1 regulatory subunit 57 antibody
Uniprot ID :
P42575
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits