Boster Immunoleader

antibody

Anti-AIF Antibody

PB9366

100 ug/vial

240 USD

polyclonal

rabbit

human, mouse, rat

western blot, immunocytochemistry, immunohistochemistry - paraffin section

info changed 20150508

Anti-AIF Antibody

PB9366

Polyclonal

Rabbit IgG polyclonal antibody for Apoptosis-inducing factor 1, mitochondrial(AIFM1) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, mouse, rat

WB,IHC-P,ICC

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Concentration: 0.5-1μg/ml; Tested Species: Human

WB: The detection limit for AIF is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P) and ICC.

Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

1. Ghezzi, D., Sevrioukova, I., Invernizzi, F., Lamperti, C., Mora, M., D'Adamo, P., Novara, F., Zuffardi, O., Uziel, G., Zeviani, M. Severe X-linked mitochondrial encephalomyopathy associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 86: 639-649, 2010. 2. Rinaldi, C., Grunseich, C., Sevrioukova, I. F., Schindler, A., Horkayne-Szakaly, I., Lamperti, C., Landoure, G., Kennerson, M. L., Burnett, B. G., Bonnemann, C., Biesecker, L. G., Ghezzi, D., Zeviani, M., Fischbeck, K. H. Cowchock syndrome is associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 91: 1095-1102, 2012. 3. Yu, S.-W., Andrabi, S. A., Wang, H., Kim, N. S., Poirier, G. G., Dawson, T. M., Dawson, V. L. Apoptosis-inducing factor mediates poly(ADP-ribose) (PAR) polymer-induced cell death. Proc. Nat. Acad. Sci. 103: 18314-18319, 2006.

AIFM1

Apoptosis-inducing factor 1, mitochondrial

apoptosis-inducing factor, mitochondrion-associated, 1

AIFM1 antibody AIFM1_HUMAN antibody Apoptosis inducing factor 1, mitochondrial antibody Apoptosis inducing factor antibody Apoptosis inducing factor, mitochondrion associated, 1 antibody Apoptosis-inducing factor 1 antibody CMTX4 antibody COXPD6 antibody Harlequin antibody Hq antibody mAIF antibody MGC111425 antibody MGC5706 antibody mitochondrial antibody Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody PDCD 8 antibody PDCD8 antibody Programmed cell death 8 (apoptosis inducing factor) antibody Programmed cell death 8 antibody Programmed cell death 8 isoform 1 antibody Programmed cell death 8 isoform 2 antibody Programmed cell death 8 isoform 3 antibody Programmed cell death protein 8 antibody Programmed cell death protein 8 mitochondrial antibody Programmed cell death protein 8 mitochondrial precursor antibody Striatal apoptosis inducing factor antibody

O95831