product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-BCRP/ABCG2 Antibody
catalog :
PB9364
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
product information
Availability :
info changed 20150601
Product Name :
Anti-BCRP/ABCG2 Antibody
Catalog Number :
PB9364
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 2(ABCG2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P,IHC-F
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human
Immunohistochemistry(Frozen Section) :
Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat
Notes :
WB: The detection limit for ABCG2 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human ABCG2(137-168aa RENLQFSAALRLATTMTNHEKNERINRVIQEL), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P)and IHC(F).
Background :
ABCG2(Atp-binding cassette, subfamily g, member 2) also known as ABCP, BCRP or MRX, is a protein that in humans is encoded by the ABCG2 gene. The ABCG2 gene encodes a membrane transporter belonging to the ATP-binding cassette (ABC) superfamily of membrane transporters, which are involved in the trafficking of biologic molecules across cell membranes. The ABCG2 protein is also a high capacity transporter for uric acid excretion in the kidney, liver, and gut. The ABCG2 gene is mapped on 4q22.1. In vitro assays of isolated membrane preparations revealed a high-capacity, vanadate-sensitive ATPase activity associated with ABCG2 expression that was stimulated by compounds known to be transported by this protein. Ozvegy et al. (2001) concluded that ABCG2 is likely functioning as a homodimer or homooligomer in this expression system since it is unlikely that putative Sf9 transport partners would be overexpressed at similarly high levels.Abcg2 transports pheophorbide-a, which occurs in various plant-derived foods and food supplements and is highly efficient in limiting its uptake from ingested food. ABCG2 is a major factor in the concentrative transfer of drugs, carcinogens, and dietary toxins to the milk of mice, cows, and humans.
Reference :
1. Jonker, J. W., Merino, G., Musters, S., van Herwaarden, A. E., Bolscher, E., Wagenaar, E., Mesman, E., Dale, T. C., Schinkel, A. H. The breast cancer resistance protein BCRP (ABCG2) concentrates drugs and carcinogenic xenotoxins into milk. Nature Med. 11: 127-129, 2005.
2. Matsuo, H., Takada, T., Ichida, K., Nakamura, T., Nakayama, A., Ikebuchi, Y., Ito, K., Kusanagi, Y., Chiba, T., Tadokoro, S., Takada, Y., Oikawa, Y., and 22 others. Common defects of ABCG2, a high-capacity urate exporter, cause gout: a function-based genetic analysis in a Japanese population.Sci. Transl. Med. 1: 5ra11, 2009.
3. Ozvegy, C., Litman, T., Szakacs, G., Nagy, Z., Bates, S., Varadi, A., Sarkadi, B. Functional characterization of the human multidrug transporter, ABCG2, expressed in insect cells.Biochem. Biophys. Res. Commun. 285: 111-117, 2001.
Gene Name :
ABCG2
Protein Name :
ATP-binding cassette sub-family G member 2
Gene Full Name :
ATP-binding cassette, sub-family G (WHITE), member 2
Synonyms :
ABC transporter antibody ABC15 antibody ABCG 2 antibody ABCG2 antibody ABCG2_HUMAN antibody ABCP antibody ATP binding cassette sub family G (WHITE) member 2 antibody ATP binding cassette transporter G2 antibody ATP-binding cassette sub-family G member 2 antibody BCRP antibody BCRP1 antibody BMDP antibody Breast cancer resistance protein antibody CD338 antibody CDw338 antibody CDw338 antigen antibody EST157481 antibody GOUT1 antibody MGC102821 antibody Mitoxantrone resistance associated protein antibody Mitoxantrone resistance-associated protein antibody MRX antibody Multi drug resistance efflux transport ATP binding cassette sub family G (WHITE) member 2 antibody MXR antibody MXR1 antibody Placenta specific ATP binding cassette transporter antibody Placenta specific MDR protein antibody Placenta-specific ATP-binding cassette transporter antibody UAQTL1 antibody
Uniprot ID :
Q9UNQ0
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
