Anti-PIM1 Antibody | Boster Immunoleader PB9315 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-PIM1 Antibody

catalog :

PB9315

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-PIM1 Antibody

Catalog Number :

PB9315

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase pim-1(PIM1) detection. Tested with WB in Human.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Notes :

WB: The detection limit for PIM1 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

Proto-oncogene serine/threonine-protein kinase Pim-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, Pim-1 has also been found to be highly expressed in cell cultures isolated from human tumors. Pim-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. PIM1 also has a role in cardioprotection downstream of AKT activation.

Reference :

1. Amson, R., Sigaux, F., Przedborski, S., Flandrin, G., Givol, D., Telerman, A. The human protooncogene product p33pim is expressed during fetal hematopoiesis and in diverse leukemias. Proc. Nat. Acad. Sci. 86: 8857-8861, 1989. 2. Bachmann M, Möröy T (April 2005). "The serine/threonine kinase Pim-1". Int. J. Biochem. Cell Biol. 37 (4): 726–30. 3. Muraski, J. A., Rota, M., Misao, Y., Fransioli, J., Cottage, C., Gude, N., Esposito, G., Delucchi, F., Arcarese, M., Alvarez, R., Siddiqi, S., Emmanuel, G. N., and 13 others. Pim-1 regulates cardiomyocyte survival downstream of Akt. Nature Med. 13: 1467-1475, 2007. Note: Erratum: Nature Med. 14: 350 only, 2008.

Gene Name :

PIM1

Protein Name :

Serine/threonine-protein kinase pim-1

Gene Full Name :

Pim-1 proto-oncogene, serine/threonine kinase

Synonyms :

Oncogene PIM 1 antibody Oncogene PIM1 antibody PIM 1 antibody pim 1 kinase 44 kDa isoform antibody Pim 1 kinase antibody pim 1 oncogene (proviral integration site 1) antibody Pim 1 oncogene antibody PIM antibody PIM1 antibody pim1 kinase 44 kDa isoform antibody PIM1_HUMAN antibody Pim2 antibody PIM3 antibody Proto oncogene serine/threonine protein kinase Pim 1 antibody Proto-oncogene serine/threonine-protein kinase Pim-1 antibody Proviral integration site 1 antibody Proviral integration site 2 antibody

Uniprot ID :

P11309

more info or order :

Boster Immunoleader product webpage