product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-MMP3 Antibody
catalog :
PB9267
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
publications citing this reagent :
  1. Zhang S, Liu H, Xu X, Zhi J, Geng J, Chen J. Effects of exercise therapy on knee joint function and synovial fluid cytokine levels in patients with knee osteoarthritis. Mol Med Rep. 2013;7:183-6 pubmed publisher
  2. Zhu L, Wei W, Zheng Y, Jia X. Effects and mechanisms of total glucosides of paeony on joint damage in rat collagen-induced arthritis. Inflamm Res. 2005;54:211-20 pubmed
product information
Product Name :
Anti-MMP3 Antibody
Catalog Number :
PB9267
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Stromelysin-1(MMP3) detection. Tested with WB in Human.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Stromelysin-1, also known as matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.
Reference :
1. "Entrez Gene: MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase) 2. Lu, P. C.-S., Ye, H., Maeda, M., Azar, D. T. Immunolocalization and gene expression of matrilysin during corneal wound healing. Invest. Ophthal. Vis. Sci. 40: 20-27, 1999. 3. Ye S, Eriksson P, Hamsten A, Kurkinen M, Humphries SE, Henney AM (May 1996). "Progression of coronary atherosclerosis is associated with a common genetic variant of the human stromelysin-1 promoter which results in reduced gene expression". J. Biol. Chem. 271 (22): 13055–60.
Gene Name :
MMP3
Protein Name :
Stromelysin-1
Gene Full Name :
matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Synonyms :
CHDS6 antibody Matrix metalloproteinase 3 antibody Matrix metalloproteinase 3 preproprotein antibody Matrix metalloproteinase-3 antibody MGC126102 antibody MGC126103 antibody MGC126104 antibody MMP 3 antibody MMP-3 antibody MMP3 antibody MMP3_HUMAN antibody Progelatinase antibody Proteoglycanase antibody SL 1 antibody SL-1 antibody SL1 antibody STMY antibody STMY1 antibody STR1 antibody Stromelisin 1 antibody Stromelysin 1 antibody Stromelysin 1 progelatinase antibody Stromelysin-1 antibody Transin 1 antibody Transin-1 antibody
Uniprot ID :
P08254
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits