product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-HIF-1-alpha Antibody
catalog :
PB9253
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-HIF-1-alpha Antibody
Catalog Number :
PB9253
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Hypoxia-inducible factor 1-alpha(HIF1A) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat
Notes :
WB: The detection limit for HIF-1-alpha is approximately 0.25ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
HIF-1α (Hypoxia-inducible factor 1α, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1α transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing. It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival. HIF-1α regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.
Reference :
1. Sutter, C. H.; Laughner, E.; Semenza, G. L. : Hypoxia-inducible factor 1-alpha protein expression is controlled by oxygen-regulated ubiquitination that is disrupted by deletions and missense mutations. Proc. Nat. Acad. Sci. 97: 4748-4753, 2000.
2. Elson, D. A.; Thurston, G.; Huang, L. E.; Ginzinger, D. G.; McDonald, D. M.; Johnson, R. S.; Arbeit, J. M. : Induction of hypervascularity without leakage or inflammation in transgenic mice overexpressing hypoxia-inducible factor-1-alpha. Genes Dev. 15: 2520-2532, 2001.
3. Koshiji, M.; To, K. K.-W.; Hammer, S.; Kumamoto, K.; Harris, A. L.; Modrich, P.; Huang, L. E. : HIF-1-alpha induces genetic instability by transcriptionally downregulating MutS-alpha expression. Molec. Cell 17: 793-803, 2005.
4. Ivan, M.; Kondo, K.; Yang, H.; Kim, W.; Valiando, J.; Ohh, M.; Salic, A.; Asara, J. M.; Lane, W. S.; Kaelin, W. G., Jr. : HIF-alpha targeted for VHL-mediated destruction by proline hydroxylation: implications for O(2) sensing. Science 292: 464-468, 2001.
Gene Name :
HIF1A
Protein Name :
Hypoxia-inducible factor 1-alpha
Gene Full Name :
hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Synonyms :
ARNT interacting protein antibody ARNT-interacting protein antibody Basic helix loop helix PAS protein MOP1 antibody Basic-helix-loop-helix-PAS protein MOP1 antibody bHLHe78 antibody Class E basic helix-loop-helix protein 78 antibody HIF 1A antibody HIF 1alpha antibody HIF-1-alpha antibody HIF1 A antibody HIF1 Alpha antibody HIF1 antibody HIF1-alpha antibody HIF1A antibody HIF1A_HUMAN antibody Hypoxia inducible factor 1 alpha antibody Hypoxia inducible factor 1 alpha isoform I.3 antibody Hypoxia inducible factor 1 alpha subunit antibody Hypoxia inducible factor 1 alpha subunit basic helix loop helix transcription factor antibody Hypoxia inducible factor 1, alpha subunit (basic helix loop helix transcription factor) antibody Hypoxia inducible factor1alpha antibody Hypoxia-inducible factor 1-alpha antibody Member of PAS protein 1 antibody Member of PAS superfamily 1 antibody Member of the PAS Superfamily 1 antibody MOP 1 antibody MOP1 antibody PAS domain-containing protein 8 antibody PASD 8 antibody PASD8 antibody
Uniprot ID :
Q16665
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments
